List of human transcription factors
This list of manually curated human transcription factors is taken from Lambert, Jolma, Campitelli et al.[1]
It was assembled by manual curation.
More detailed information is found in the manuscript and the web site accompanying the paper (Human Transcription Factors)
List of human transcription factors (1639)
Gene | ID | DBD | Motif status (Feb 2018) (Link to human TFs annotation) | IUPAC consensus (from selected PWM) |
---|---|---|---|---|
AC008770.3 | ENSG00000267179 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
AC023509.3 | ENSG00000267281 | bZIP | Known motif – from protein with 100% identical DBD – in vitro | RTGACGTCAY |
AC092835.1 | ENSG00000233757 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
AC138696.1 | ENSG00000264668 | C2H2 ZF | Known motif – from protein with 100% identical DBD – in vitro | RYGGAGAGTTAGC |
ADNP | ENSG00000101126 | Homeodomain | Likely sequence specific TF according to literature or domain structure – No motif | |
ADNP2 | ENSG00000101544 | Homeodomain | Likely sequence specific TF according to literature or domain structure – No motif | |
AEBP1 | ENSG00000106624 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
AEBP2 | ENSG00000139154 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
AHCTF1 | ENSG00000153207 | AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
AHDC1 | ENSG00000126705 | AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
AHR | ENSG00000106546 | bHLH | Known motif – In vivo/Misc source | BKNGCGTGHV |
AHRR | ENSG00000063438 | bHLH | Inferred motif from similar protein – In vivo/Misc source | BKNGCGTGHV |
AIRE | ENSG00000160224 | SAND | Known motif – In vivo/Misc source | HNNGGWWNWDWWGGDBDH |
AKAP8 | ENSG00000105127 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
AKAP8L | ENSG00000011243 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
AKNA | ENSG00000106948 | AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
ALX1 | ENSG00000180318 | Homeodomain | Known motif – High-throughput in vitro | TAATYTAATTA |
ALX3 | ENSG00000156150 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
ALX4 | ENSG00000052850 | Homeodomain | Known motif – High-throughput in vitro | TAATYNRRTTA |
ANHX | ENSG00000227059 | Homeodomain | Known motif – High-throughput in vitro | KTKACAWG |
ANKZF1 | ENSG00000163516 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
AR | ENSG00000169083 | Nuclear receptor | Known motif – High-throughput in vitro | RGGWACRHBDYGTWCYH |
ARGFX | ENSG00000186103 | Homeodomain | Known motif – High-throughput in vitro | DYTAATTAR |
ARHGAP35 | ENSG00000160007 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
ARID2 | ENSG00000189079 | ARID/BRIGHT; RFX | Likely sequence specific TF according to literature or domain structure – No motif | |
ARID3A | ENSG00000116017 | ARID/BRIGHT | Known motif – from protein with 100% identical DBD – in vitro | DATHAAD |
ARID3B | ENSG00000179361 | ARID/BRIGHT | Inferred motif from similar protein – High-throughput in vitro | WWTTAATH |
ARID3C | ENSG00000205143 | ARID/BRIGHT | Inferred motif from similar protein – High-throughput in vitro | DATHAAD |
ARID5A | ENSG00000196843 | ARID/BRIGHT | Known motif – from protein with 100% identical DBD – in vitro | HAATATTD |
ARID5B | ENSG00000150347 | ARID/BRIGHT | Known motif – from protein with 100% identical DBD – in vitro | DATWH |
ARNT | ENSG00000143437 | bHLH | Known motif – from protein with 100% identical DBD – in vitro | KCACGTGM |
ARNT2 | ENSG00000172379 | bHLH | Known motif – High-throughput in vitro | RDCACGTGM |
ARNTL | ENSG00000133794 | bHLH | Known motif – High-throughput in vitro | GTCACGTGAC |
ARNTL2 | ENSG00000029153 | bHLH | Inferred motif from similar protein – High-throughput in vitro | CACGTGAY |
ARX | ENSG00000004848 | Homeodomain | Known motif – High-throughput in vitro | TAATYNRATTA |
ASCL1 | ENSG00000139352 | bHLH | Known motif – High-throughput in vitro | RCASSTGY |
ASCL2 | ENSG00000183734 | bHLH | Known motif – High-throughput in vitro | RCAGCTGY |
ASCL3 | ENSG00000176009 | bHLH | Inferred motif from similar protein – High-throughput in vitro | RCASSTGY |
ASCL4 | ENSG00000187855 | bHLH | Inferred motif from similar protein – High-throughput in vitro | RCASSTGY |
ASCL5 | ENSG00000232237 | bHLH | Inferred motif from similar protein – High-throughput in vitro | RCASSTGY |
ASH1L | ENSG00000116539 | AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
ATF1 | ENSG00000123268 | bZIP | Known motif – In vivo/Misc source | VTGACGTSAV |
ATF2 | ENSG00000115966 | bZIP | Known motif – High-throughput in vitro | VTKACGTMAB |
ATF3 | ENSG00000162772 | bZIP | Known motif – High-throughput in vitro | RTGACGTCAY |
ATF4 | ENSG00000128272 | bZIP | Known motif – High-throughput in vitro | RKATGACGTCATMY |
ATF5 | ENSG00000169136 | bZIP | Known motif – In vivo/Misc source | WAAGGRAGARR |
ATF6 | ENSG00000118217 | bZIP | Known motif – High-throughput in vitro | YKRTGACGTGGCA |
ATF6B | ENSG00000213676 | bZIP | Known motif – High-throughput in vitro | RTGACGTGGCR |
ATF7 | ENSG00000170653 | bZIP | Known motif – High-throughput in vitro | DRTGACGTCAT |
ATMIN | ENSG00000166454 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ATOH1 | ENSG00000172238 | bHLH | Known motif – High-throughput in vitro | RACAGCTGYY |
ATOH7 | ENSG00000179774 | bHLH | Known motif – High-throughput in vitro | RVCATATGBT |
ATOH8 | ENSG00000168874 | bHLH | Inferred motif from similar protein – High-throughput in vitro | AAWTANNNBRMCATATGKY |
BACH1 | ENSG00000156273 | bZIP | Known motif – In vivo/Misc source | RTGACTCAGCANWWH |
BACH2 | ENSG00000112182 | bZIP | Known motif – High-throughput in vitro | WDNSATGASTCATGNWW |
BARHL1 | ENSG00000125492 | Homeodomain | Known motif – High-throughput in vitro | TAAWYG |
BARHL2 | ENSG00000143032 | Homeodomain | Known motif – High-throughput in vitro | TAAWBG |
BARX1 | ENSG00000131668 | Homeodomain | Known motif – High-throughput in vitro | TAATBGNWWWTTAATBR |
BARX2 | ENSG00000043039 | Homeodomain | Known motif – High-throughput in vitro | TAAYKRTTWW |
BATF | ENSG00000156127 | bZIP | Known motif – High-throughput in vitro | VVYGMCAC |
BATF2 | ENSG00000168062 | bZIP | Likely sequence specific TF according to literature or domain structure – No motif | |
BATF3 | ENSG00000123685 | bZIP | Known motif – High-throughput in vitro | VTGACGTCAYV |
BAZ2A | ENSG00000076108 | MBD; AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
BAZ2B | ENSG00000123636 | MBD | Likely sequence specific TF according to literature or domain structure – No motif | |
BBX | ENSG00000114439 | HMG/Sox | Known motif – High-throughput in vitro | TGAWCDNYGWTCA |
BCL11A | ENSG00000119866 | C2H2 ZF | Known motif – In vivo/Misc source | DDRRGGAASTGARAV |
BCL11B | ENSG00000127152 | C2H2 ZF | Known motif – High-throughput in vitro | GTGAACGBNDNNVCTACAC |
BCL6 | ENSG00000113916 | C2H2 ZF | Known motif – High-throughput in vitro | YGCTTTCKAGGAAH |
BCL6B | ENSG00000161940 | C2H2 ZF | Known motif – High-throughput in vitro | GCTTTCKAGGAAH |
BHLHA15 | ENSG00000180535 | bHLH | Known motif – High-throughput in vitro | VCATATGB |
BHLHA9 | ENSG00000205899 | bHLH | Likely sequence specific TF according to literature or domain structure – No motif | |
BHLHE22 | ENSG00000180828 | bHLH | Known motif – High-throughput in vitro | AVCATATGBT |
BHLHE23 | ENSG00000125533 | bHLH | Known motif – High-throughput in vitro | AVCATATGBY |
BHLHE40 | ENSG00000134107 | bHLH | Known motif – High-throughput in vitro | DKCACGTGM |
BHLHE41 | ENSG00000123095 | bHLH | Known motif – High-throughput in vitro | RKCACGTGAY |
BNC1 | ENSG00000169594 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | CCRCCWTCA |
BNC2 | ENSG00000173068 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | CCRCCWTCA |
BORCS8-MEF2B | ENSG00000064489 | MADS box | Known motif – from protein with 100% identical DBD – in vitro | CCDWWWHNRG |
BPTF | ENSG00000171634 | Unknown | Known motif – In vivo/Misc source | KKKNTTGTKKNV |
BRF2 | ENSG00000104221 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
BSX | ENSG00000188909 | Homeodomain | Known motif – High-throughput in vitro | TAATBR |
C11orf95 | ENSG00000188070 | BED ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
CAMTA1 | ENSG00000171735 | CG-1 | Likely sequence specific TF according to literature or domain structure – No motif | |
CAMTA2 | ENSG00000108509 | CG-1 | Likely sequence specific TF according to literature or domain structure – No motif | |
CARF | ENSG00000138380 | Unknown | Known motif – In vivo/Misc source | GCCTCGTTYTSR |
CASZ1 | ENSG00000130940 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
CBX2 | ENSG00000173894 | AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
CC2D1A | ENSG00000132024 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
CCDC169-SOHLH2 | ENSG00000250709 | bHLH | Known motif – from protein with 100% identical DBD – in vitro | BCACGTGC |
CCDC17 | ENSG00000159588 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
CDC5L | ENSG00000096401 | Myb/SANT | Known motif – In vivo/Misc source | VBGWKDTAAYRWAWB |
CDX1 | ENSG00000113722 | Homeodomain | Known motif – High-throughput in vitro | TTTATKRB |
CDX2 | ENSG00000165556 | Homeodomain | Known motif – High-throughput in vitro | DWWATKRB |
CDX4 | ENSG00000131264 | Homeodomain | Known motif – High-throughput in vitro | VKTTTATKRCH |
CEBPA | ENSG00000245848 | bZIP | Known motif – from protein with 100% identical DBD – in vitro | TTGCGHAA |
CEBPB | ENSG00000172216 | bZIP | Known motif – High-throughput in vitro | VTTRCGCAAY |
CEBPD | ENSG00000221869 | bZIP | Known motif – High-throughput in vitro | VTTRCGCAAY |
CEBPE | ENSG00000092067 | bZIP | Known motif – High-throughput in vitro | VTTRCGCAAY |
CEBPG | ENSG00000153879 | bZIP | Known motif – High-throughput in vitro | RTTRCGCAAY |
CEBPZ | ENSG00000115816 | Unknown | Known motif – In vivo/Misc source | DSTSATTGGCT |
CENPA | ENSG00000115163 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
CENPB | ENSG00000125817 | CENPB | Known motif – High-throughput in vitro | TWCGYNNNAHRCGGG |
CENPBD1 | ENSG00000177946 | CENPB | Known motif – High-throughput in vitro | WNYGWAD |
CENPS | ENSG00000175279 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
CENPT | ENSG00000102901 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
CENPX | ENSG00000169689 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
CGGBP1 | ENSG00000163320 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
CHAMP1 | ENSG00000198824 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
CHCHD3 | ENSG00000106554 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
CIC | ENSG00000079432 | HMG/Sox | Known motif – from protein with 100% identical DBD – in vitro | VTCAGCA |
CLOCK | ENSG00000134852 | bHLH | Known motif – High-throughput in vitro | DACACGTGYH |
CPEB1 | ENSG00000214575 | Unknown | Known motif – High-throughput in vitro | HTTTTATH |
CPXCR1 | ENSG00000147183 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
CREB1 | ENSG00000118260 | bZIP | Known motif – High-throughput in vitro | VTKACGTMA |
CREB3 | ENSG00000107175 | bZIP | Known motif – High-throughput in vitro | RTGACGTGKH |
CREB3L1 | ENSG00000157613 | bZIP | Known motif – High-throughput in vitro | TGCCACGTGGCR |
CREB3L2 | ENSG00000182158 | bZIP | Known motif – from protein with 100% identical DBD – in vitro | HCACGTGKM |
CREB3L3 | ENSG00000060566 | bZIP | Likely sequence specific TF according to literature or domain structure – No motif | |
CREB3L4 | ENSG00000143578 | bZIP | Known motif – High-throughput in vitro | VTGACGTGGM |
CREB5 | ENSG00000146592 | bZIP | Known motif – High-throughput in vitro | VTKACRTMAB |
CREBL2 | ENSG00000111269 | bZIP | Inferred motif from similar protein – High-throughput in vitro | ATKACGTMAY |
CREBZF | ENSG00000137504 | bZIP | Inferred motif from similar protein – High-throughput in vitro | WWACGTWD |
CREM | ENSG00000095794 | bZIP | Known motif – High-throughput in vitro | VVTBACGTVAB |
CRX | ENSG00000105392 | Homeodomain | Known motif – High-throughput in vitro | TAATCC |
CSRNP1 | ENSG00000144655 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
CSRNP2 | ENSG00000110925 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
CSRNP3 | ENSG00000178662 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
CTCF | ENSG00000102974 | C2H2 ZF | Known motif – High-throughput in vitro | CCDSBAGGKGGCGCB |
CTCFL | ENSG00000124092 | C2H2 ZF | Known motif – In vivo/Misc source | CCNSYAGGGGGCGCY |
CUX1 | ENSG00000257923 | CUT; Homeodomain | Known motif – High-throughput in vitro | ATYGATHA |
CUX2 | ENSG00000111249 | CUT; Homeodomain | Known motif – High-throughput in vitro | DDATYGATYA |
CXXC1 | ENSG00000154832 | CxxC | Known motif – High-throughput in vitro | BCG |
CXXC4 | ENSG00000168772 | CxxC | Likely sequence specific TF according to literature or domain structure – No motif | |
CXXC5 | ENSG00000171604 | CxxC | Known motif – High-throughput in vitro | DCK |
DACH1 | ENSG00000276644 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
DACH2 | ENSG00000126733 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
DBP | ENSG00000105516 | bZIP | Known motif – High-throughput in vitro | RTTAYRTAAB |
DBX1 | ENSG00000109851 | Homeodomain | Inferred motif from similar protein – High-throughput in vitro | WTTAATTA |
DBX2 | ENSG00000185610 | Homeodomain | Inferred motif from similar protein – High-throughput in vitro | AH |
DDIT3 | ENSG00000175197 | bZIP | Known motif – In vivo/Misc source | RVVKATTGCANNB |
DEAF1 | ENSG00000177030 | SAND | Inferred motif from similar protein – In vivo/Misc source | VCRBNYYCGKGDRYTTCCGDVDNNB |
DLX1 | ENSG00000144355 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
DLX2 | ENSG00000115844 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
DLX3 | ENSG00000064195 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
DLX4 | ENSG00000108813 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
DLX5 | ENSG00000105880 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
DLX6 | ENSG00000006377 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
DMBX1 | ENSG00000197587 | Homeodomain | Known motif – High-throughput in vitro | HTAATCCB |
DMRT1 | ENSG00000137090 | DM | Known motif – High-throughput in vitro | GHWACWH |
DMRT2 | ENSG00000173253 | DM | Known motif – High-throughput in vitro | DATAMATT |
DMRT3 | ENSG00000064218 | DM | Known motif – High-throughput in vitro | DWWTTGWTACAWT |
DMRTA1 | ENSG00000176399 | DM | Known motif – High-throughput in vitro | DDWTGHTACAW |
DMRTA2 | ENSG00000142700 | DM | Known motif – High-throughput in vitro | DHBGHWACADB |
DMRTB1 | ENSG00000143006 | DM | Likely sequence specific TF according to literature or domain structure – No motif | |
DMRTC2 | ENSG00000142025 | DM | Known motif – High-throughput in vitro | WWTTGHTACAW |
DMTF1 | ENSG00000135164 | Myb/SANT | Likely sequence specific TF according to literature or domain structure – No motif | |
DNMT1 | ENSG00000130816 | CxxC | Known motif – High-throughput in vitro | CGG |
DNTTIP1 | ENSG00000101457 | AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
DOT1L | ENSG00000104885 | AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
DPF1 | ENSG00000011332 | C2H2 ZF | Known motif – High-throughput in vitro | KMTATAGGBG |
DPF3 | ENSG00000205683 | C2H2 ZF | Inferred motif from similar protein – High-throughput in vitro | KMTATAGGBG |
DPRX | ENSG00000204595 | Homeodomain | Known motif – High-throughput in vitro | RGMTAATCY |
DR1 | ENSG00000117505 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
DRAP1 | ENSG00000175550 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
DRGX | ENSG00000165606 | Homeodomain | Known motif – High-throughput in vitro | TAATYNAATTA |
DUX1 | DUX1_HUMAN | Homeodomain | Known motif – In vivo/Misc source | ATAATCTGATTAT |
DUX3 | DUX3_HUMAN | Homeodomain | Known motif – In vivo/Misc source | TTAATTAAATTAA |
DUX4 | ENSG00000260596 | Homeodomain | Known motif – In vivo/Misc source | TGATTRRRTTA |
DUXA | ENSG00000258873 | Homeodomain | Known motif – High-throughput in vitro | TGATTRVRTYD |
DZIP1 | ENSG00000134874 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
E2F1 | ENSG00000101412 | E2F | Known motif – High-throughput in vitro | WTTGGCGCCHWW |
E2F2 | ENSG00000007968 | E2F | Known motif – High-throughput in vitro | WDWWGGCGCCHWWH |
E2F3 | ENSG00000112242 | E2F | Known motif – High-throughput in vitro | TTTTGGCGCCMTTTTY |
E2F4 | ENSG00000205250 | E2F | Known motif – High-throughput in vitro | TTTGGCGCCAAA |
E2F5 | ENSG00000133740 | E2F | Known motif – In vivo/Misc source | TTTSGCGC |
E2F6 | ENSG00000169016 | E2F | Known motif – In vivo/Misc source | DGGMGGGARV |
E2F7 | ENSG00000165891 | E2F | Known motif – High-throughput in vitro | WTTTGGCGGGAAAH |
E2F8 | ENSG00000129173 | E2F | Known motif – High-throughput in vitro | TTTGGCGGGAAA |
E4F1 | ENSG00000167967 | C2H2 ZF | Known motif – In vivo/Misc source | RTGACGTARS |
EBF1 | ENSG00000164330 | EBF1 | Known motif – High-throughput in vitro | ANTCCCHWGGGAHH |
EBF2 | ENSG00000221818 | EBF1 | Known motif – In vivo/Misc source | VTGMAACCCCCWWTHVK |
EBF3 | ENSG00000108001 | EBF1 | Known motif – In vivo/Misc source | BTCCCYWGRGD |
EBF4 | ENSG00000088881 | EBF1 | Known motif – In vivo/Misc source | CGSATAACCMTTGTTATCAB |
EEA1 | ENSG00000102189 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
EGR1 | ENSG00000120738 | C2H2 ZF | Known motif – High-throughput in vitro | MCGCCCMCGCA |
EGR2 | ENSG00000122877 | C2H2 ZF | Known motif – High-throughput in vitro | MCGCCCACGCD |
EGR3 | ENSG00000179388 | C2H2 ZF | Known motif – High-throughput in vitro | HMCGCCCMCGCAH |
EGR4 | ENSG00000135625 | C2H2 ZF | Known motif – High-throughput in vitro | HMCGCCCACGCAH |
EHF | ENSG00000135373 | Ets | Known motif – High-throughput in vitro | ACCCGGAAGTD |
ELF1 | ENSG00000120690 | Ets | Known motif – High-throughput in vitro | WHSCGGAAGY |
ELF2 | ENSG00000109381 | Ets | Known motif – High-throughput in vitro | AMCCGGAAGTV |
ELF3 | ENSG00000163435 | Ets; AT hook | Known motif – High-throughput in vitro | WACCCGGAAGTR |
ELF4 | ENSG00000102034 | Ets | Known motif – High-throughput in vitro | ABSCGGAAGTR |
ELF5 | ENSG00000135374 | Ets | Known motif – High-throughput in vitro | WNVMGGAARY |
ELK1 | ENSG00000126767 | Ets | Known motif – High-throughput in vitro | RCCGGAAGT |
ELK3 | ENSG00000111145 | Ets | Known motif – High-throughput in vitro | RCCGGAAGT |
ELK4 | ENSG00000158711 | Ets | Known motif – High-throughput in vitro | ACCGGAARY |
EMX1 | ENSG00000135638 | Homeodomain | Known motif – High-throughput in vitro | BTAATTR |
EMX2 | ENSG00000170370 | Homeodomain | Known motif – High-throughput in vitro | BTAATTA |
EN1 | ENSG00000163064 | Homeodomain | Known motif – High-throughput in vitro | TAATTRVB |
EN2 | ENSG00000164778 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
EOMES | ENSG00000163508 | T-box | Known motif – High-throughput in vitro | WTCACACCTH |
EPAS1 | ENSG00000116016 | bHLH | Known motif – In vivo/Misc source | VDACGTGHH |
ERF | ENSG00000105722 | Ets | Known motif – High-throughput in vitro | ACCGGAARTV |
ERG | ENSG00000157554 | Ets | Known motif – High-throughput in vitro | ACCGGAARY |
ESR1 | ENSG00000091831 | Nuclear receptor | Known motif – High-throughput in vitro | AGGTCAYSRTGACCT |
ESR2 | ENSG00000140009 | Nuclear receptor | Known motif – from protein with 100% identical DBD – in vitro | RGGTCAH |
ESRRA | ENSG00000173153 | Nuclear receptor | Known motif – High-throughput in vitro | SAAGGTCA |
ESRRB | ENSG00000119715 | Nuclear receptor | Known motif – High-throughput in vitro | TCAAGGTCAWH |
ESRRG | ENSG00000196482 | Nuclear receptor | Known motif – High-throughput in vitro | SAAGGTCR |
ESX1 | ENSG00000123576 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
ETS1 | ENSG00000134954 | Ets | Known motif – High-throughput in vitro | RCCGGAWRYRYWTCCGSH |
ETS2 | ENSG00000157557 | Ets | Known motif – High-throughput in vitro | ACCGGAWGYRCWTCCGGT |
ETV1 | ENSG00000006468 | Ets | Known motif – High-throughput in vitro | RCCGGAWRY |
ETV2 | ENSG00000105672 | Ets | Known motif – High-throughput in vitro | DACCGGAARYD |
ETV3 | ENSG00000117036 | Ets | Known motif – High-throughput in vitro | AHCGGAWWTCCGNT |
ETV3L | ENSG00000253831 | Ets | Known motif – from protein with 100% identical DBD – in vitro | VGGAWR |
ETV4 | ENSG00000175832 | Ets | Known motif – High-throughput in vitro | RCCGGAWGY |
ETV5 | ENSG00000244405 | Ets | Known motif – High-throughput in vitro | DVCGGAWRY |
ETV6 | ENSG00000139083 | Ets | Known motif – High-throughput in vitro | SCGGAASCGGAAGYR |
ETV7 | ENSG00000010030 | Ets | Known motif – High-throughput in vitro | VVGGAAGYRCTTCCBB |
EVX1 | ENSG00000106038 | Homeodomain | Known motif – High-throughput in vitro | TAATBRB |
EVX2 | ENSG00000174279 | Homeodomain | Known motif – High-throughput in vitro | TAATBRB |
FAM170A | ENSG00000164334 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
FAM200B | ENSG00000237765 | BED ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
FBXL19 | ENSG00000099364 | CxxC | Likely sequence specific TF according to literature or domain structure – No motif | |
FERD3L | ENSG00000146618 | bHLH | Known motif – High-throughput in vitro | GYRMCAGCTGTBRC |
FEV | ENSG00000163497 | Ets | Known motif – High-throughput in vitro | ACCGGAART |
FEZF1 | ENSG00000128610 | C2H2 ZF | Known motif – High-throughput in vitro | AAAARRRCAV |
FEZF2 | ENSG00000153266 | C2H2 ZF | Inferred motif from similar protein – High-throughput in vitro | AAAWGAGCAATCA |
FIGLA | ENSG00000183733 | bHLH | Known motif – High-throughput in vitro | MCAGGTGKD |
FIZ1 | ENSG00000179943 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
FLI1 | ENSG00000151702 | Ets | Known motif – High-throughput in vitro | RCCGGAWRY |
FLYWCH1 | ENSG00000059122 | FLYWCH | Likely sequence specific TF according to literature or domain structure – No motif | |
FOS | ENSG00000170345 | bZIP | Known motif – High-throughput in vitro | BRTGACGTCAYV |
FOSB | ENSG00000125740 | bZIP | Known motif – High-throughput in vitro | RTGACGTCAY |
FOSL1 | ENSG00000175592 | bZIP | Known motif – High-throughput in vitro | DRTGAYRCR |
FOSL2 | ENSG00000075426 | bZIP | Known motif – High-throughput in vitro | TKANTCAYNRTGACGTCAY |
FOXA1 | ENSG00000129514 | Forkhead | Known motif – High-throughput in vitro | BVYTAWGTAAACAAW |
FOXA2 | ENSG00000125798 | Forkhead | Known motif – High-throughput in vitro | HNNGTMAATATTKRYNBD |
FOXA3 | ENSG00000170608 | Forkhead | Known motif – High-throughput in vitro | BVYTAWGTAAACAAA |
FOXB1 | ENSG00000171956 | Forkhead | Known motif – High-throughput in vitro | WRWGTMAATATTKACWYW |
FOXB2 | ENSG00000204612 | Forkhead | Inferred motif from similar protein – High-throughput in vitro | HWRWGYMAATATTKRCHYW |
FOXC1 | ENSG00000054598 | Forkhead | Known motif – High-throughput in vitro | WRWRTMAAYAW |
FOXC2 | ENSG00000176692 | Forkhead | Known motif – High-throughput in vitro | WAHRTMAAYAWW |
FOXD1 | ENSG00000251493 | Forkhead | Known motif – from protein with 100% identical DBD – in vitro | HWASAATAAYAWW |
FOXD2 | ENSG00000186564 | Forkhead | Known motif – High-throughput in vitro | RTAAAYA |
FOXD3 | ENSG00000187140 | Forkhead | Known motif – High-throughput in vitro | RTAAAYA |
FOXD4 | ENSG00000170122 | Forkhead | Inferred motif from similar protein – In vivo/Misc source | GTTAAAGCVAKTTTAA |
FOXD4L1 | ENSG00000184492 | Forkhead | Inferred motif from similar protein – In vivo/Misc source | GTTAAAGCVAKTTTAA |
FOXD4L3 | ENSG00000187559 | Forkhead | Inferred motif from similar protein – In vivo/Misc source | MGGTAAATCMAGGGWWT |
FOXD4L4 | ENSG00000184659 | Forkhead | Known motif – In vivo/Misc source | MGGTAAATCMAGGGWWT |
FOXD4L5 | ENSG00000204779 | Forkhead | Inferred motif from similar protein – In vivo/Misc source | MGGTAAATCMAGGGWWT |
FOXD4L6 | ENSG00000273514 | Forkhead | Inferred motif from similar protein – In vivo/Misc source | MGGTAAATCMAGGGWWT |
FOXE1 | ENSG00000178919 | Forkhead | Known motif – High-throughput in vitro | BVYTAWRYAAACAD |
FOXE3 | ENSG00000186790 | Forkhead | Inferred motif from similar protein – High-throughput in vitro | BVYTAWRYAAACAD |
FOXF1 | ENSG00000103241 | Forkhead | Known motif – In vivo/Misc source | YRHATAAACAHNB |
FOXF2 | ENSG00000137273 | Forkhead | Known motif – In vivo/Misc source | BNHNBRTAAACAHNV |
FOXG1 | ENSG00000176165 | Forkhead | Known motif – High-throughput in vitro | RTAAACAH |
FOXH1 | ENSG00000160973 | Forkhead | Known motif – In vivo/Misc source | BNSAATMCACA |
FOXI1 | ENSG00000168269 | Forkhead | Known motif – High-throughput in vitro | RTMAACA |
FOXI2 | ENSG00000186766 | Forkhead | Inferred motif from similar protein – High-throughput in vitro | RTMAACA |
FOXI3 | ENSG00000214336 | Forkhead | Inferred motif from similar protein – High-throughput in vitro | RTMAACA |
FOXJ1 | ENSG00000129654 | Forkhead | Known motif – from protein with 100% identical DBD – in vitro | HAAACAAA |
FOXJ2 | ENSG00000065970 | Forkhead | Known motif – High-throughput in vitro | GTAAACAWMAACA |
FOXJ3 | ENSG00000198815 | Forkhead | Known motif – High-throughput in vitro | RTAAACAW |
FOXK1 | ENSG00000164916 | Forkhead | Known motif – High-throughput in vitro | RWMMAYA |
FOXK2 | ENSG00000141568 | Forkhead | Inferred motif from similar protein – High-throughput in vitro | RWMAACAA |
FOXL1 | ENSG00000176678 | Forkhead | Known motif – High-throughput in vitro | RTAAACA |
FOXL2 | ENSG00000183770 | Forkhead | Known motif – High-throughput in vitro | VBGHMAACAH |
FOXM1 | ENSG00000111206 | Forkhead | Known motif – from protein with 100% identical DBD – in vitro | RWHR |
FOXN1 | ENSG00000109101 | Forkhead | Known motif – In vivo/Misc source | WVBSACGCB |
FOXN2 | ENSG00000170802 | Forkhead | Known motif – High-throughput in vitro | GCGTSNNNNNSACGC |
FOXN3 | ENSG00000053254 | Forkhead | Known motif – High-throughput in vitro | GTAAACAA |
FOXN4 | ENSG00000139445 | Forkhead | Known motif – In vivo/Misc source | WHNWRRNGACGCYATNHM |
FOXO1 | ENSG00000150907 | Forkhead | Known motif – High-throughput in vitro | RTAAACATGTTTAC |
FOXO3 | ENSG00000118689 | Forkhead | Known motif – High-throughput in vitro | GTAAACAW |
FOXO4 | ENSG00000184481 | Forkhead | Known motif – High-throughput in vitro | GTAAACA |
FOXO6 | ENSG00000204060 | Forkhead | Known motif – High-throughput in vitro | GTAAACATGTTTAC |
FOXP1 | ENSG00000114861 | Forkhead | Known motif – High-throughput in vitro | TGTTTRYNRTNNNNNNBNAYRVWMAACA |
FOXP2 | ENSG00000128573 | Forkhead | Known motif – High-throughput in vitro | RTAAAYAW |
FOXP3 | ENSG00000049768 | Forkhead | Known motif – High-throughput in vitro | RTAAACA |
FOXP4 | ENSG00000137166 | Forkhead | Inferred motif from similar protein – High-throughput in vitro | RTMAAYA |
FOXQ1 | ENSG00000164379 | Forkhead | Known motif – High-throughput in vitro | YWRHRTAAACWD |
FOXR1 | ENSG00000176302 | Forkhead | Known motif – High-throughput in vitro | CAADY |
FOXR2 | ENSG00000189299 | Forkhead | Known motif – High-throughput in vitro | RYRTAWACATAAAWRHH |
FOXS1 | ENSG00000179772 | Forkhead | Inferred motif from similar protein – High-throughput in vitro | HNNRHMAAYA |
GABPA | ENSG00000154727 | Ets | Known motif – High-throughput in vitro | RSCGGAWRY |
GATA1 | ENSG00000102145 | GATA | Known motif – High-throughput in vitro | GATWASMH |
GATA2 | ENSG00000179348 | GATA | Known motif – High-throughput in vitro | VHGATAHSV |
GATA3 | ENSG00000107485 | GATA | Known motif – High-throughput in vitro | HGATAAVV |
GATA4 | ENSG00000136574 | GATA | Known motif – High-throughput in vitro | HGATAAVV |
GATA5 | ENSG00000130700 | GATA | Known motif – High-throughput in vitro | HGATAASV |
GATA6 | ENSG00000141448 | GATA | Known motif – High-throughput in vitro | HGATAABVATCD |
GATAD2A | ENSG00000167491 | GATA | Likely sequence specific TF according to literature or domain structure – No motif | |
GATAD2B | ENSG00000143614 | GATA | Likely sequence specific TF according to literature or domain structure – No motif | |
GBX1 | ENSG00000164900 | Homeodomain | Known motif – High-throughput in vitro | BTAATTRSB |
GBX2 | ENSG00000168505 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
GCM1 | ENSG00000137270 | GCM | Known motif – High-throughput in vitro | BATGCGGGTRS |
GCM2 | ENSG00000124827 | GCM | Known motif – High-throughput in vitro | HRCCCGCAT |
GFI1 | ENSG00000162676 | C2H2 ZF | Known motif – High-throughput in vitro | BMAATCACDGCNHBBCACTM |
GFI1B | ENSG00000165702 | C2H2 ZF | Known motif – High-throughput in vitro | MAATCASDGCNNBBCACT |
GLI1 | ENSG00000111087 | C2H2 ZF | Known motif – In vivo/Misc source | SMCCHCCCA |
GLI2 | ENSG00000074047 | C2H2 ZF | Known motif – High-throughput in vitro | GMCCACMCANVNHB |
GLI3 | ENSG00000106571 | C2H2 ZF | Known motif – High-throughput in vitro | VGACCACCCACVNHG |
GLI4 | ENSG00000250571 | C2H2 ZF | Known motif – In vivo/Misc source | RRGCCTTGAATGCCANGNYMA |
GLIS1 | ENSG00000174332 | C2H2 ZF | Known motif – High-throughput in vitro | MGACCCCCCACGWHG |
GLIS2 | ENSG00000126603 | C2H2 ZF | Known motif – High-throughput in vitro | KACCCCCCRCRDHG |
GLIS3 | ENSG00000107249 | C2H2 ZF | Known motif – High-throughput in vitro | KACCCCCCACRAAG |
GLMP | ENSG00000198715 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
GLYR1 | ENSG00000140632 | AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
GMEB1 | ENSG00000162419 | SAND | Known motif – High-throughput in vitro | KTACGTAMNKTACGTMM |
GMEB2 | ENSG00000101216 | SAND | Known motif – High-throughput in vitro | YBACGYAM |
GPBP1 | ENSG00000062194 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
GPBP1L1 | ENSG00000159592 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
GRHL1 | ENSG00000134317 | Grainyhead | Known motif – High-throughput in vitro | DAACCGGTTH |
GRHL2 | ENSG00000083307 | Grainyhead | Known motif – In vivo/Misc source | RAACHDGHHHDDCHDGTTY |
GRHL3 | ENSG00000158055 | Grainyhead | Likely sequence specific TF according to literature or domain structure – No motif | |
GSC | ENSG00000133937 | Homeodomain | Known motif – High-throughput in vitro | HTAATCC |
GSC2 | ENSG00000063515 | Homeodomain | Known motif – High-throughput in vitro | HTAATCCBH |
GSX1 | ENSG00000169840 | Homeodomain | Known motif – High-throughput in vitro | TAATKR |
GSX2 | ENSG00000180613 | Homeodomain | Known motif – High-throughput in vitro | TAATKR |
GTF2B | ENSG00000137947 | Unknown | Known motif – In vivo/Misc source | STYWYAKASTS |
GTF2I | ENSG00000263001 | GTF2I-like | Known motif – In vivo/Misc source | VAGVDVKTSH |
GTF2IRD1 | ENSG00000006704 | GTF2I-like | Known motif – In vivo/Misc source | TRTCGCWG |
GTF2IRD2 | ENSG00000196275 | GTF2I-like | Likely sequence specific TF according to literature or domain structure – No motif | |
GTF2IRD2B | ENSG00000174428 | GTF2I-like | Likely sequence specific TF according to literature or domain structure – No motif | |
GTF3A | ENSG00000122034 | C2H2 ZF | Known motif – High-throughput in vitro | GGATGGGAG |
GZF1 | ENSG00000125812 | C2H2 ZF | Known motif – In vivo/Misc source | TATAKAVGCGCA |
HAND1 | ENSG00000113196 | bHLH | Known motif – In vivo/Misc source | DBRTCTGGHWDH |
HAND2 | ENSG00000164107 | bHLH | Known motif – High-throughput in vitro | HVCAGGTGTK |
HBP1 | ENSG00000105856 | HMG/Sox | Known motif – from protein with 100% identical DBD – in vitro | DD |
HDX | ENSG00000165259 | Homeodomain | Known motif – High-throughput in vitro | H |
HELT | ENSG00000187821 | bHLH | Inferred motif from similar protein – High-throughput in vitro | BBCACGTGY |
HES1 | ENSG00000114315 | bHLH | Known motif – High-throughput in vitro | KDCRCGTGBB |
HES2 | ENSG00000069812 | bHLH | Known motif – High-throughput in vitro | VRCACGTGCC |
HES3 | ENSG00000173673 | bHLH | Inferred motif from similar protein – High-throughput in vitro | KDCRCGTGBB |
HES4 | ENSG00000188290 | bHLH | Inferred motif from similar protein – High-throughput in vitro | KDCRCGTGBB |
HES5 | ENSG00000197921 | bHLH | Known motif – High-throughput in vitro | HGGCACGTGYCR |
HES6 | ENSG00000144485 | bHLH | Known motif – High-throughput in vitro | DACACGTGCC |
HES7 | ENSG00000179111 | bHLH | Known motif – High-throughput in vitro | YGGCACGTGCCR |
HESX1 | ENSG00000163666 | Homeodomain | Known motif – High-throughput in vitro | HTAATTRVH |
HEY1 | ENSG00000164683 | bHLH | Known motif – High-throughput in vitro | BBCRCGYGY |
HEY2 | ENSG00000135547 | bHLH | Known motif – High-throughput in vitro | BCACGTGB |
HEYL | ENSG00000163909 | bHLH | Inferred motif from similar protein – High-throughput in vitro | BCACGTGB |
HHEX | ENSG00000152804 | Homeodomain | Inferred motif from similar protein – High-throughput in vitro | ATND |
HIC1 | ENSG00000177374 | C2H2 ZF | Known motif – High-throughput in vitro | RTGCCMMC |
HIC2 | ENSG00000169635 | C2H2 ZF | Known motif – High-throughput in vitro | BKGGCAY |
HIF1A | ENSG00000100644 | bHLH | Known motif – In vivo/Misc source | VVNGCACGTMBNS |
HIF3A | ENSG00000124440 | bHLH | Inferred motif from similar protein – In vivo/Misc source | RWAWWTMATAWCST |
HINFP | ENSG00000172273 | C2H2 ZF | Known motif – High-throughput in vitro | GCGGACGYTRSRRCGTCCGC |
HIVEP1 | ENSG00000095951 | C2H2 ZF | Known motif – In vivo/Misc source | KGRRRARTCCCB |
HIVEP2 | ENSG00000010818 | C2H2 ZF | Known motif – In vivo/Misc source | KBYDNGGHAABNSS |
HIVEP3 | ENSG00000127124 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | KBYDNGGHAABNSS |
HKR1 | ENSG00000181666 | C2H2 ZF | Known motif – High-throughput in vitro | VBKVRVNRDGGAGGRBVNVR |
HLF | ENSG00000108924 | bZIP | Known motif – High-throughput in vitro | VTTAYRTAAY |
HLX | ENSG00000136630 | Homeodomain | Known motif – from protein with 100% identical DBD – in vitro | AWND |
HMBOX1 | ENSG00000147421 | Homeodomain | Known motif – High-throughput in vitro | VYTAGTTAMV |
HMG20A | ENSG00000140382 | HMG/Sox | Likely sequence specific TF according to literature or domain structure – No motif | |
HMG20B | ENSG00000064961 | HMG/Sox | Inferred motif from similar protein – High-throughput in vitro | WDWATAAT |
HMGA1 | ENSG00000137309 | AT hook | Known motif – In vivo/Misc source | WATTWW |
HMGA2 | ENSG00000149948 | AT hook | Known motif – In vivo/Misc source | ATATTSSSSDWWAWT |
HMGN3 | ENSG00000118418 | HMG/Sox | Likely sequence specific TF according to literature or domain structure – No motif | |
HMX1 | ENSG00000215612 | Homeodomain | Known motif – High-throughput in vitro | TTAAKTGNY |
HMX2 | ENSG00000188816 | Homeodomain | Known motif – High-throughput in vitro | TTAAKTG |
HMX3 | ENSG00000188620 | Homeodomain | Known motif – High-throughput in vitro | TAAKTG |
HNF1A | ENSG00000135100 | Homeodomain | Known motif – High-throughput in vitro | GTTAATNATTAAY |
HNF1B | ENSG00000275410 | Homeodomain | Known motif – High-throughput in vitro | GTTAATNATTAAY |
HNF4A | ENSG00000101076 | Nuclear receptor | Known motif – High-throughput in vitro | VRGGTCAAAGTCCA |
HNF4G | ENSG00000164749 | Nuclear receptor | Known motif – In vivo/Misc source | GDNCAAAGKYCA |
HOMEZ | ENSG00000215271 | Homeodomain | Known motif – High-throughput in vitro | WWWAATCGTTTW |
HOXA1 | ENSG00000105991 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
HOXA10 | ENSG00000253293 | Homeodomain | Known motif – High-throughput in vitro | TTWAYGAY |
HOXA11 | ENSG00000005073 | Homeodomain | Known motif – High-throughput in vitro | DWTTTACGACB |
HOXA13 | ENSG00000106031 | Homeodomain | Known motif – High-throughput in vitro | DTTTTATKRS |
HOXA2 | ENSG00000105996 | Homeodomain | Known motif – High-throughput in vitro | BTAATKR |
HOXA3 | ENSG00000105997 | Homeodomain | Known motif – from protein with 100% identical DBD – in vitro | TAATKR |
HOXA4 | ENSG00000197576 | Homeodomain | Known motif – High-throughput in vitro | TAATKRY |
HOXA5 | ENSG00000106004 | Homeodomain | Known motif – High-throughput in vitro | STAATKRS |
HOXA6 | ENSG00000106006 | Homeodomain | Known motif – High-throughput in vitro | TAATKRV |
HOXA7 | ENSG00000122592 | Homeodomain | Known motif – High-throughput in vitro | TAATKRV |
HOXA9 | ENSG00000078399 | Homeodomain | Known motif – High-throughput in vitro | DTTWAYGAY |
HOXB1 | ENSG00000120094 | Homeodomain | Known motif – High-throughput in vitro | STAATTA |
HOXB13 | ENSG00000159184 | Homeodomain | Known motif – High-throughput in vitro | TTWAYDD |
HOXB2 | ENSG00000173917 | Homeodomain | Known motif – High-throughput in vitro | TAATKR |
HOXB3 | ENSG00000120093 | Homeodomain | Known motif – High-throughput in vitro | BTAATKR |
HOXB4 | ENSG00000182742 | Homeodomain | Known motif – High-throughput in vitro | YTAATKAY |
HOXB5 | ENSG00000120075 | Homeodomain | Known motif – High-throughput in vitro | TAATKRV |
HOXB6 | ENSG00000108511 | Homeodomain | Known motif – High-throughput in vitro | TAATKRY |
HOXB7 | ENSG00000260027 | Homeodomain | Known motif – High-throughput in vitro | BTAATKRV |
HOXB8 | ENSG00000120068 | Homeodomain | Known motif – High-throughput in vitro | TAATKRM |
HOXB9 | ENSG00000170689 | Homeodomain | Known motif – High-throughput in vitro | WTTTAYGAY |
HOXC10 | ENSG00000180818 | Homeodomain | Known motif – High-throughput in vitro | WTTWAYGAB |
HOXC11 | ENSG00000123388 | Homeodomain | Known motif – High-throughput in vitro | WTTWAYGAYH |
HOXC12 | ENSG00000123407 | Homeodomain | Known motif – High-throughput in vitro | DTTTTACGAYY |
HOXC13 | ENSG00000123364 | Homeodomain | Known motif – High-throughput in vitro | CTCGTAAAAH |
HOXC4 | ENSG00000198353 | Homeodomain | Known motif – High-throughput in vitro | TAATKR |
HOXC5 | ENSG00000172789 | Homeodomain | Known motif – from protein with 100% identical DBD – in vitro | WRATND |
HOXC6 | ENSG00000197757 | Homeodomain | Known motif – from protein with 100% identical DBD – in vitro | TTAATTAB |
HOXC8 | ENSG00000037965 | Homeodomain | Known motif – High-throughput in vitro | YAATTR |
HOXC9 | ENSG00000180806 | Homeodomain | Known motif – High-throughput in vitro | TTTTACGAC |
HOXD1 | ENSG00000128645 | Homeodomain | Known motif – High-throughput in vitro | BTAATTAV |
HOXD10 | ENSG00000128710 | Homeodomain | Known motif – High-throughput in vitro | DTTTTACGACY |
HOXD11 | ENSG00000128713 | Homeodomain | Known motif – High-throughput in vitro | DWTTTACGAY |
HOXD12 | ENSG00000170178 | Homeodomain | Known motif – High-throughput in vitro | DTTTACGAY |
HOXD13 | ENSG00000128714 | Homeodomain | Known motif – High-throughput in vitro | BCTCGTAAAAH |
HOXD3 | ENSG00000128652 | Homeodomain | Known motif – High-throughput in vitro | CTAATTAS |
HOXD4 | ENSG00000170166 | Homeodomain | Known motif – High-throughput in vitro | TMATKRV |
HOXD8 | ENSG00000175879 | Homeodomain | Known motif – High-throughput in vitro | HWMATTWDB |
HOXD9 | ENSG00000128709 | Homeodomain | Known motif – High-throughput in vitro | TTTTATKRC |
HSF1 | ENSG00000185122 | HSF | Known motif – High-throughput in vitro | VGAABVTTCBVGAW |
HSF2 | ENSG00000025156 | HSF | Known motif – High-throughput in vitro | VGAANNTTCBVGAA |
HSF4 | ENSG00000102878 | HSF | Known motif – High-throughput in vitro | GAANNTTCBVGAA |
HSF5 | ENSG00000176160 | HSF | Known motif – High-throughput in vitro | RCGTTCTAGAAYGY |
HSFX1 | ENSG00000171116 | HSF | Likely sequence specific TF according to literature or domain structure – No motif | |
HSFX2 | ENSG00000268738 | HSF | Likely sequence specific TF according to literature or domain structure – No motif | |
HSFY1 | ENSG00000172468 | HSF | Known motif – High-throughput in vitro | DTVGAAYGWTTCGAAYGB |
HSFY2 | ENSG00000169953 | HSF | Known motif – High-throughput in vitro | DTCGAAHSNWTCGAW |
IKZF1 | ENSG00000185811 | C2H2 ZF | Known motif – In vivo/Misc source | BTGGGARD |
IKZF2 | ENSG00000030419 | C2H2 ZF | Known motif – In vivo/Misc source | HDWHGGGADD |
IKZF3 | ENSG00000161405 | C2H2 ZF | Known motif – High-throughput in vitro | VSNNGGGAA |
IKZF4 | ENSG00000123411 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | HDWHGGGADD |
IKZF5 | ENSG00000095574 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | MYYATGCAGRGT |
INSM1 | ENSG00000173404 | C2H2 ZF | Known motif – In vivo/Misc source | YRMCCCCWKRCA |
INSM2 | ENSG00000168348 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
IRF1 | ENSG00000125347 | IRF | Known motif – In vivo/Misc source | GAAASTGAAASY |
IRF2 | ENSG00000168310 | IRF | Known motif – High-throughput in vitro | GAAAVYGAAAS |
IRF3 | ENSG00000126456 | IRF | Known motif – High-throughput in vitro | HSGAAAVBGAAACYGAAAC |
IRF4 | ENSG00000137265 | IRF | Known motif – High-throughput in vitro | HCGAAACCGAAACYW |
IRF5 | ENSG00000128604 | IRF | Known motif – High-throughput in vitro | CGAAACCGAWACH |
IRF6 | ENSG00000117595 | IRF | Known motif – High-throughput in vitro | RGTWTCRNNNNNNCGAWACY |
IRF7 | ENSG00000185507 | IRF | Known motif – High-throughput in vitro | CGAAAVYGAAANY |
IRF8 | ENSG00000140968 | IRF | Known motif – High-throughput in vitro | CGAAACYGAAACY |
IRF9 | ENSG00000213928 | IRF | Known motif – High-throughput in vitro | AWCGAAACCGAAACY |
IRX1 | ENSG00000170549 | Homeodomain | Known motif – High-throughput in vitro | DDCRHNNNNNNNNDYGHH |
IRX2 | ENSG00000170561 | Homeodomain | Known motif – High-throughput in vitro | DTGTYRTGTH |
IRX3 | ENSG00000177508 | Homeodomain | Known motif – High-throughput in vitro | DACAHGNWWWWNCDTGTH |
IRX4 | ENSG00000113430 | Homeodomain | Known motif – from protein with 100% identical DBD – in vitro | DAMAH |
IRX5 | ENSG00000176842 | Homeodomain | Known motif – High-throughput in vitro | DTGTYRTGTH |
IRX6 | ENSG00000159387 | Homeodomain | Inferred motif from similar protein – High-throughput in vitro | DAMAH |
ISL1 | ENSG00000016082 | Homeodomain | Known motif – High-throughput in vitro | BTAAKTGS |
ISL2 | ENSG00000159556 | Homeodomain | Known motif – High-throughput in vitro | YTAAKTGB |
ISX | ENSG00000175329 | Homeodomain | Known motif – High-throughput in vitro | CYAATTAV |
JAZF1 | ENSG00000153814 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
JDP2 | ENSG00000140044 | bZIP | Known motif – High-throughput in vitro | RTKACRTMAY |
JRK | ENSG00000234616 | CENPB | Likely sequence specific TF according to literature or domain structure – No motif | |
JRKL | ENSG00000183340 | CENPB | Inferred motif from similar protein – High-throughput in vitro | RCGGWWR |
JUN | ENSG00000177606 | bZIP | Known motif – High-throughput in vitro | DATGACGTMAHNV |
JUNB | ENSG00000171223 | bZIP | Known motif – High-throughput in vitro | RTKACGTMAY |
JUND | ENSG00000130522 | bZIP | Known motif – High-throughput in vitro | VTGACGTMA |
KAT7 | ENSG00000136504 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
KCMF1 | ENSG00000176407 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
KCNIP3 | ENSG00000115041 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
KDM2A | ENSG00000173120 | CxxC | Likely sequence specific TF according to literature or domain structure – No motif | |
KDM2B | ENSG00000089094 | CxxC | Known motif – High-throughput in vitro | CG |
KDM5B | ENSG00000117139 | ARID/BRIGHT | Likely sequence specific TF according to literature or domain structure – No motif | |
KIN | ENSG00000151657 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
KLF1 | ENSG00000105610 | C2H2 ZF | Known motif – High-throughput in vitro | CMCGCCCM |
KLF10 | ENSG00000155090 | C2H2 ZF | Known motif – High-throughput in vitro | RMCACRCCCMYVHCACRCCCMC |
KLF11 | ENSG00000172059 | C2H2 ZF | Known motif – High-throughput in vitro | VMCMCRCCCMYNMCACGCCCMC |
KLF12 | ENSG00000118922 | C2H2 ZF | Known motif – High-throughput in vitro | DRCCACGCCCH |
KLF13 | ENSG00000169926 | C2H2 ZF | Known motif – High-throughput in vitro | RCCACRCCCMC |
KLF14 | ENSG00000266265 | C2H2 ZF | Known motif – High-throughput in vitro | DRHCACGCCCMYYH |
KLF15 | ENSG00000163884 | C2H2 ZF | Known motif – High-throughput in vitro | VHCMCVCCCMY |
KLF16 | ENSG00000129911 | C2H2 ZF | Known motif – High-throughput in vitro | VMCMCDCCCMC |
KLF17 | ENSG00000171872 | C2H2 ZF | Known motif – High-throughput in vitro | MMCCACVCWCCCMTY |
KLF2 | ENSG00000127528 | C2H2 ZF | Known motif – High-throughput in vitro | VCCMCRCCCH |
KLF3 | ENSG00000109787 | C2H2 ZF | Known motif – High-throughput in vitro | RRCCRCGCCCH |
KLF4 | ENSG00000136826 | C2H2 ZF | Known motif – High-throughput in vitro | VCCACRCCCH |
KLF5 | ENSG00000102554 | C2H2 ZF | Known motif – High-throughput in vitro | MCACRCCCH |
KLF6 | ENSG00000067082 | C2H2 ZF | Known motif – High-throughput in vitro | VMCACRCCCH |
KLF7 | ENSG00000118263 | C2H2 ZF | Known motif – from protein with 100% identical DBD – in vitro | HHMCRCCCH |
KLF8 | ENSG00000102349 | C2H2 ZF | Known motif – from protein with 100% identical DBD – in vitro | MCRCCY |
KLF9 | ENSG00000119138 | C2H2 ZF | Known motif – from protein with 100% identical DBD – in vitro | TAACGG |
KMT2A | ENSG00000118058 | CxxC; AT hook | Known motif – High-throughput in vitro | HNCGNB |
KMT2B | ENSG00000272333 | CxxC; AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
L3MBTL1 | ENSG00000185513 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
L3MBTL3 | ENSG00000198945 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
L3MBTL4 | ENSG00000154655 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
LBX1 | ENSG00000138136 | Homeodomain | Known motif – High-throughput in vitro | TAAYTRG |
LBX2 | ENSG00000179528 | Homeodomain | Known motif – High-throughput in vitro | TAATTRV |
LCOR | ENSG00000196233 | Pipsqueak | Known motif – from protein with 100% identical DBD – in vitro | YNAAW |
LCORL | ENSG00000178177 | Pipsqueak | Known motif – High-throughput in vitro | HYNAAWH |
LEF1 | ENSG00000138795 | HMG/Sox | Known motif – High-throughput in vitro | SATCAAAS |
LEUTX | ENSG00000213921 | Homeodomain | Likely sequence specific TF according to literature or domain structure – No motif | |
LHX1 | ENSG00000273706 | Homeodomain | Known motif – High-throughput in vitro | TRATBR |
LHX2 | ENSG00000106689 | Homeodomain | Known motif – High-throughput in vitro | HHDTTR |
LHX3 | ENSG00000107187 | Homeodomain | Known motif – from protein with 100% identical DBD – in vitro | YAATHW |
LHX4 | ENSG00000121454 | Homeodomain | Known motif – High-throughput in vitro | BYRATTRV |
LHX5 | ENSG00000089116 | Homeodomain | Known motif – High-throughput in vitro | TAATTRS |
LHX6 | ENSG00000106852 | Homeodomain | Known motif – High-throughput in vitro | TRATTR |
LHX8 | ENSG00000162624 | Homeodomain | Known motif – High-throughput in vitro | STAATTA |
LHX9 | ENSG00000143355 | Homeodomain | Known motif – High-throughput in vitro | TAATTRG |
LIN28A | ENSG00000131914 | CSD | Inferred motif from similar protein – High-throughput in vitro | CGCHGYYHYWYCGCG |
LIN28B | ENSG00000187772 | CSD | Known motif – High-throughput in vitro | CGCHGYYHYWYCGCG |
LIN54 | ENSG00000189308 | TCR/CxC | Inferred motif from similar protein – High-throughput in vitro | RTTYAAAH |
LMX1A | ENSG00000162761 | Homeodomain | Known motif – High-throughput in vitro | BTAATTA |
LMX1B | ENSG00000136944 | Homeodomain | Known motif – High-throughput in vitro | TWATTR |
LTF | ENSG00000012223 | Unknown | Known motif – In vivo/Misc source | GKVACTKB |
LYL1 | ENSG00000104903 | bHLH | Inferred motif from similar protein – In vivo/Misc source | RNCAGVTGGH |
MAF | ENSG00000178573 | bZIP | Known motif – High-throughput in vitro | TGCTGACDHDRCR |
MAFA | ENSG00000182759 | bZIP | Known motif – High-throughput in vitro | WWWNTGCTGACD |
MAFB | ENSG00000204103 | bZIP | Known motif – from protein with 100% identical DBD – in vitro | TGCTGAC |
MAFF | ENSG00000185022 | bZIP | Known motif – High-throughput in vitro | YGCTGASTCAGCR |
MAFG | ENSG00000197063 | bZIP | Known motif – High-throughput in vitro | YGCTGABNDNGCR |
MAFK | ENSG00000198517 | bZIP | Known motif – High-throughput in vitro | DNNYGCTKAVTCAGCRNNH |
MAX | ENSG00000125952 | bHLH | Known motif – High-throughput in vitro | CACGTG |
MAZ | ENSG00000103495 | C2H2 ZF | Known motif – High-throughput in vitro | GGGMGGGGS |
MBD1 | ENSG00000141644 | MBD; CxxC ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
MBD2 | ENSG00000134046 | MBD | Known motif – In vivo/Misc source | VSGKCCGGMKR |
MBD3 | ENSG00000071655 | MBD | Likely sequence specific TF according to literature or domain structure – No motif | |
MBD4 | ENSG00000129071 | MBD | Likely sequence specific TF according to literature or domain structure – No motif | |
MBD6 | ENSG00000166987 | MBD | Likely sequence specific TF according to literature or domain structure – No motif | |
MBNL2 | ENSG00000139793 | CCCH ZF | Likely sequence specific TF according to literature or domain structure – High-throughput in vitro | YGCYTYGCYTH |
MECOM | ENSG00000085276 | C2H2 ZF | Known motif – In vivo/Misc source | WGAYAAGATAANAND |
MECP2 | ENSG00000169057 | MBD; AT hook | Known motif – from protein with 100% identical DBD – in vitro | DTD |
MEF2A | ENSG00000068305 | MADS box | Known motif – High-throughput in vitro | KCTAWAAATAGM |
MEF2B | ENSG00000213999 | MADS box | Known motif – High-throughput in vitro | TGTTACCATAWHBGG |
MEF2C | ENSG00000081189 | MADS box | Known motif – High-throughput in vitro | TWCTAWAAATAG |
MEF2D | ENSG00000116604 | MADS box | Known motif – High-throughput in vitro | DCTAWAAATAGM |
MEIS1 | ENSG00000143995 | Homeodomain | Known motif – High-throughput in vitro | TGACA |
MEIS2 | ENSG00000134138 | Homeodomain | Known motif – High-throughput in vitro | TGACASSTGTC |
MEIS3 | ENSG00000105419 | Homeodomain | Known motif – High-throughput in vitro | TGACAGSTGTCA |
MEOX1 | ENSG00000005102 | Homeodomain | Known motif – High-throughput in vitro | STAATTA |
MEOX2 | ENSG00000106511 | Homeodomain | Known motif – High-throughput in vitro | STMATYA |
MESP1 | ENSG00000166823 | bHLH | Known motif – High-throughput in vitro | HVCACCTGB |
MESP2 | ENSG00000188095 | bHLH | Known motif – High-throughput in vitro | AMCATATGKYR |
MGA | ENSG00000174197 | T-box | Known motif – High-throughput in vitro | AGGTGTKAHDTMACACCT |
MITF | ENSG00000187098 | bHLH | Known motif – from protein with 100% identical DBD – in vitro | RTCACGHG |
MIXL1 | ENSG00000185155 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
MKX | ENSG00000150051 | Homeodomain | Likely sequence specific TF according to literature or domain structure – No motif | |
MLX | ENSG00000108788 | bHLH | Known motif – High-throughput in vitro | VCACGTGVY |
MLXIP | ENSG00000175727 | bHLH | Inferred motif from similar protein – High-throughput in vitro | HCACGTGV |
MLXIPL | ENSG00000009950 | bHLH | Known motif – High-throughput in vitro | DDCACGTGNH |
MNT | ENSG00000070444 | bHLH | Known motif – High-throughput in vitro | DNCACGTGB |
MNX1 | ENSG00000130675 | Homeodomain | Known motif – High-throughput in vitro | HTAATTRNH |
MSANTD1 | ENSG00000188981 | MADF | Likely sequence specific TF according to literature or domain structure – No motif | |
MSANTD3 | ENSG00000066697 | MADF | Known motif – High-throughput in vitro | SBNCACTCAM |
MSANTD4 | ENSG00000170903 | Myb/SANT | Likely sequence specific TF according to literature or domain structure – No motif | |
MSC | ENSG00000178860 | bHLH | Known motif – High-throughput in vitro | RMCAGCTGBYV |
MSGN1 | ENSG00000151379 | bHLH | Known motif – High-throughput in vitro | VMCAWWTGGY |
MSX1 | ENSG00000163132 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
MSX2 | ENSG00000120149 | Homeodomain | Known motif – High-throughput in vitro | TAATTGB |
MTERF1 | ENSG00000127989 | mTERF | Known motif – In vivo/Misc source | TGGTAVWRKTYGGT |
MTERF2 | ENSG00000120832 | mTERF | Likely sequence specific TF according to literature or domain structure – No motif | |
MTERF3 | ENSG00000156469 | mTERF | Likely sequence specific TF according to literature or domain structure – No motif | |
MTERF4 | ENSG00000122085 | mTERF | Likely sequence specific TF according to literature or domain structure – No motif | |
MTF1 | ENSG00000188786 | C2H2 ZF | Known motif – High-throughput in vitro | TTTGCACACGGCAC |
MTF2 | ENSG00000143033 | Unknown | Known motif – High-throughput in vitro | |
MXD1 | ENSG00000059728 | bHLH | Inferred motif from similar protein – In vivo/Misc source | CACGTGAY |
MXD3 | ENSG00000213347 | bHLH | Inferred motif from similar protein – In vivo/Misc source | CACGTGAY |
MXD4 | ENSG00000123933 | bHLH | Inferred motif from similar protein – In vivo/Misc source | CACGTGAY |
MXI1 | ENSG00000119950 | bHLH | Known motif – In vivo/Misc source | CCACGTGG |
MYB | ENSG00000118513 | Myb/SANT | Known motif – In vivo/Misc source | BAACKGNH |
MYBL1 | ENSG00000185697 | Myb/SANT | Known motif – High-throughput in vitro | HRACCGTTW |
MYBL2 | ENSG00000101057 | Myb/SANT | Known motif – High-throughput in vitro | WAACGGTY |
MYC | ENSG00000136997 | bHLH | Known motif – In vivo/Misc source | RCCACGTGSB |
MYCL | ENSG00000116990 | bHLH | Inferred motif from similar protein – In vivo/Misc source | RCCACGTG |
MYCN | ENSG00000134323 | bHLH | Known motif – High-throughput in vitro | VCACGTG |
MYF5 | ENSG00000111049 | bHLH | Known motif – In vivo/Misc source | VCWSCASSTGYCW |
MYF6 | ENSG00000111046 | bHLH | Known motif – High-throughput in vitro | RACASSTGWYV |
MYNN | ENSG00000085274 | C2H2 ZF | Known motif – High-throughput in vitro | AAAWTAARAGYC |
MYOD1 | ENSG00000129152 | bHLH | Known motif – High-throughput in vitro | YGHCAGSTGKYV |
MYOG | ENSG00000122180 | bHLH | Known motif – High-throughput in vitro | RACARCTGWCR |
MYPOP | ENSG00000176182 | Myb/SANT | Likely sequence specific TF according to literature or domain structure – No motif | |
MYRF | ENSG00000124920 | Ndt80/PhoG | Known motif – High-throughput in vitro | TGGTACCA |
MYRFL | ENSG00000166268 | Ndt80/PhoG | Likely sequence specific TF according to literature or domain structure – No motif | |
MYSM1 | ENSG00000162601 | Myb/SANT | Likely sequence specific TF according to literature or domain structure – No motif | |
MYT1 | ENSG00000196132 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
MYT1L | ENSG00000186487 | C2H2 ZF | Inferred motif from similar protein – High-throughput in vitro | VAAGTTT |
MZF1 | ENSG00000099326 | C2H2 ZF | Known motif – In vivo/Misc source | DRDGGGGAD |
NACC2 | ENSG00000148411 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
NAIF1 | ENSG00000171169 | MADF | Inferred motif from similar protein – High-throughput in vitro | TACGYH |
NANOG | ENSG00000111704 | Homeodomain | Known motif – High-throughput in vitro | YRABBVB |
NANOGNB | ENSG00000205857 | Homeodomain | Likely sequence specific TF according to literature or domain structure – No motif | |
NANOGP8 | ENSG00000255192 | Homeodomain | Known motif – from protein with 100% identical DBD – in vitro | YRABBVB |
NCOA1 | ENSG00000084676 | bHLH | Likely sequence specific TF according to literature or domain structure – No motif | |
NCOA2 | ENSG00000140396 | bHLH | Likely sequence specific TF according to literature or domain structure – No motif | |
NCOA3 | ENSG00000124151 | bHLH | Likely sequence specific TF according to literature or domain structure – No motif | |
NEUROD1 | ENSG00000162992 | bHLH | Known motif – High-throughput in vitro | AAWTANNNBRMCATATGKY |
NEUROD2 | ENSG00000171532 | bHLH | Known motif – High-throughput in vitro | RMCATATGBY |
NEUROD4 | ENSG00000123307 | bHLH | Inferred motif from similar protein – High-throughput in vitro | AAWTANNNBRMCATATGKY |
NEUROD6 | ENSG00000164600 | bHLH | Inferred motif from similar protein – High-throughput in vitro | AAWTANNNBRMCATATGKY |
NEUROG1 | ENSG00000181965 | bHLH | Known motif – High-throughput in vitro | RVCATATGBY |
NEUROG2 | ENSG00000178403 | bHLH | Known motif – High-throughput in vitro | RVCATATGBY |
NEUROG3 | ENSG00000122859 | bHLH | Inferred motif from similar protein – High-throughput in vitro | RVCATATGBY |
NFAT5 | ENSG00000102908 | Rel | Known motif – High-throughput in vitro | RTGGAAAWKTACH |
NFATC1 | ENSG00000131196 | Rel | Known motif – High-throughput in vitro | RTGGAAAHW |
NFATC2 | ENSG00000101096 | Rel | Known motif – High-throughput in vitro | DYGGAAANW |
NFATC3 | ENSG00000072736 | Rel | Known motif – High-throughput in vitro | YGGAAANH |
NFATC4 | ENSG00000100968 | Rel | Known motif – High-throughput in vitro | YRBWWW |
NFE2 | ENSG00000123405 | bZIP | Known motif – High-throughput in vitro | VATGACTCATB |
NFE2L1 | ENSG00000082641 | bZIP | Known motif – In vivo/Misc source | ATGAYD |
NFE2L2 | ENSG00000116044 | bZIP | Known motif – In vivo/Misc source | VVTGACTMAGCA |
NFE2L3 | ENSG00000050344 | bZIP | Known motif – In vivo/Misc source | TATTWSCAAGGA |
NFE4 | ENSG00000230257 | Unknown | Known motif – In vivo/Misc source | VHCCCKMKCCWS |
NFIA | ENSG00000162599 | SMAD | Known motif – High-throughput in vitro | YTGGCANNNTGCCAA |
NFIB | ENSG00000147862 | SMAD | Known motif – High-throughput in vitro | TTGGCANNNTGCCAR |
NFIC | ENSG00000141905 | SMAD | Known motif – High-throughput in vitro | YTGGCANNNNGCCAA |
NFIL3 | ENSG00000165030 | bZIP | Known motif – High-throughput in vitro | VTTACRTAAY |
NFIX | ENSG00000008441 | SMAD | Known motif – High-throughput in vitro | TTGGCANNNTGCCAR |
NFKB1 | ENSG00000109320 | Rel | Known motif – High-throughput in vitro | AGGGGAWTCCCCK |
NFKB2 | ENSG00000077150 | Rel | Known motif – High-throughput in vitro | VGGGGAWTCCCC |
NFX1 | ENSG00000086102 | NFX | Likely sequence specific TF according to literature or domain structure – No motif | |
NFXL1 | ENSG00000170448 | NFX | Likely sequence specific TF according to literature or domain structure – No motif | |
NFYA | ENSG00000001167 | CBF/NF-Y | Known motif – In vivo/Misc source | HBSYSATTGGYYV |
NFYB | ENSG00000120837 | Unknown | Known motif – In vivo/Misc source | CTSATTGGYYVVNNB |
NFYC | ENSG00000066136 | Unknown | Known motif – In vivo/Misc source | BSTSATTGGYYR |
NHLH1 | ENSG00000171786 | bHLH | Known motif – High-throughput in vitro | DKGRCGCAGCTGMKNCH |
NHLH2 | ENSG00000177551 | bHLH | Known motif – High-throughput in vitro | DDGNMGCAGCTGCGYCMH |
NKRF | ENSG00000186416 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
NKX1-1 | ENSG00000235608 | Homeodomain | Known motif – from protein with 100% identical DBD – in vitro | TAATND |
NKX1-2 | ENSG00000229544 | Homeodomain | Known motif – from protein with 100% identical DBD – in vitro | TAAWND |
NKX2-1 | ENSG00000136352 | Homeodomain | Known motif – from protein with 100% identical DBD – in vitro | RAGDR |
NKX2-2 | ENSG00000125820 | Homeodomain | Known motif – from protein with 100% identical DBD – in vitro | RAGDR |
NKX2-3 | ENSG00000119919 | Homeodomain | Known motif – High-throughput in vitro | VCACTTV |
NKX2-4 | ENSG00000125816 | Homeodomain | Known motif – from protein with 100% identical DBD – in vitro | RAGDR |
NKX2-5 | ENSG00000183072 | Homeodomain | Known motif – High-throughput in vitro | VCACTTRDV |
NKX2-6 | ENSG00000180053 | Homeodomain | Inferred motif from similar protein – High-throughput in vitro | HYAAGTRB |
NKX2-8 | ENSG00000136327 | Homeodomain | Known motif – High-throughput in vitro | BTSRAGTGB |
NKX3-1 | ENSG00000167034 | Homeodomain | Known motif – High-throughput in vitro | TAAGTGS |
NKX3-2 | ENSG00000109705 | Homeodomain | Known motif – High-throughput in vitro | TAAGTGS |
NKX6-1 | ENSG00000163623 | Homeodomain | Known motif – from protein with 100% identical DBD – in vitro | DTDATNR |
NKX6-2 | ENSG00000148826 | Homeodomain | Known motif – High-throughput in vitro | DTAATTR |
NKX6-3 | ENSG00000165066 | Homeodomain | Known motif – High-throughput in vitro | WTAATGRB |
NME2 | ENSG00000243678 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
NOBOX | ENSG00000106410 | Homeodomain | Known motif – High-throughput in vitro | HDATDR |
NOTO | ENSG00000214513 | Homeodomain | Known motif – High-throughput in vitro | YWMATTA |
NPAS1 | ENSG00000130751 | bHLH | Inferred motif from similar protein – In vivo/Misc source | VVNGCACGTMBNS |
NPAS2 | ENSG00000170485 | bHLH | Known motif – High-throughput in vitro | DMCACGTGY |
NPAS3 | ENSG00000151322 | bHLH | Inferred motif from similar protein – In vivo/Misc source | VVNGCACGTMBNS |
NPAS4 | ENSG00000174576 | bHLH | Inferred motif from similar protein – High-throughput in vitro | |
NR0B1 | ENSG00000169297 | Unknown | Known motif – In vivo/Misc source | YBTYCCMCKS |
NR1D1 | ENSG00000126368 | Nuclear receptor | Known motif – High-throughput in vitro | TGACCYASTRACCYANWW |
NR1D2 | ENSG00000174738 | Nuclear receptor | Known motif – High-throughput in vitro | YRACMYANTRACMYMNWWH |
NR1H2 | ENSG00000131408 | Nuclear receptor | Known motif – In vivo/Misc source | TAAAGGTCAAAGGTCAASK |
NR1H3 | ENSG00000025434 | Nuclear receptor | Inferred motif from similar protein – In vivo/Misc source | TAAAGGTCAAAGGTCAASK |
NR1H4 | ENSG00000012504 | Nuclear receptor | Known motif – High-throughput in vitro | RGKTCRTTGACCYBNNRGGTBADRGKKBNDRGKTCAHHKD |
NR1I2 | ENSG00000144852 | Nuclear receptor | Known motif – High-throughput in vitro | YGMMCYBNNYGMMCY |
NR1I3 | ENSG00000143257 | Nuclear receptor | Known motif – High-throughput in vitro | RGKDYRNNNNRGKKYR |
NR2C1 | ENSG00000120798 | Nuclear receptor | Known motif – High-throughput in vitro | RGKKCRYGAMMY |
NR2C2 | ENSG00000177463 | Nuclear receptor | Known motif – High-throughput in vitro | VRGGTCAAAGGTCA |
NR2E1 | ENSG00000112333 | Nuclear receptor | Known motif – High-throughput in vitro | AAGTCA |
NR2E3 | ENSG00000278570 | Nuclear receptor | Known motif – High-throughput in vitro | RAGATCAM |
NR2F1 | ENSG00000175745 | Nuclear receptor | Known motif – High-throughput in vitro | RRGGTCAAAGGTCA |
NR2F2 | ENSG00000185551 | Nuclear receptor | Known motif – from protein with 100% identical DBD – in vitro | RRGGTCA |
NR2F6 | ENSG00000160113 | Nuclear receptor | Known motif – High-throughput in vitro | RGGTCAAAGGTCA |
NR3C1 | ENSG00000113580 | Nuclear receptor | Known motif – High-throughput in vitro | RGWACAYNRTGTWCYH |
NR3C2 | ENSG00000151623 | Nuclear receptor | Known motif – High-throughput in vitro | RGDACAHDRTGTHCY |
NR4A1 | ENSG00000123358 | Nuclear receptor | Known motif – High-throughput in vitro | AAAGGTCA |
NR4A2 | ENSG00000153234 | Nuclear receptor | Known motif – High-throughput in vitro | BTAAAGGTCA |
NR4A3 | ENSG00000119508 | Nuclear receptor | Known motif – In vivo/Misc source | CAAAGGTCAS |
NR5A1 | ENSG00000136931 | Nuclear receptor | Known motif – High-throughput in vitro | CAAGGYCR |
NR5A2 | ENSG00000116833 | Nuclear receptor | Known motif – High-throughput in vitro | YCAAGGTCAH |
NR6A1 | ENSG00000148200 | Nuclear receptor | Known motif – High-throughput in vitro | SAAGKTCAAGKKYR |
NRF1 | ENSG00000106459 | Unknown | Known motif – High-throughput in vitro | YRCGCATGCGC |
NRL | ENSG00000129535 | bZIP | Known motif – High-throughput in vitro | DWHNYGCTGAC |
OLIG1 | ENSG00000184221 | bHLH | Known motif – High-throughput in vitro | AVCATATGKT |
OLIG2 | ENSG00000205927 | bHLH | Known motif – High-throughput in vitro | AMCATATGKY |
OLIG3 | ENSG00000177468 | bHLH | Known motif – High-throughput in vitro | RSCATATGKY |
ONECUT1 | ENSG00000169856 | CUT; Homeodomain | Known motif – High-throughput in vitro | DDTATCGATYD |
ONECUT2 | ENSG00000119547 | CUT; Homeodomain | Known motif – High-throughput in vitro | DTATCGATCS |
ONECUT3 | ENSG00000205922 | CUT; Homeodomain | Known motif – High-throughput in vitro | DWTATYGATTTTY |
OSR1 | ENSG00000143867 | C2H2 ZF | Known motif – High-throughput in vitro | HACRGTAGC |
OSR2 | ENSG00000164920 | C2H2 ZF | Known motif – High-throughput in vitro | HVCRGTAGC |
OTP | ENSG00000171540 | Homeodomain | Known motif – from protein with 100% identical DBD – in vitro | HAATND |
OTX1 | ENSG00000115507 | Homeodomain | Known motif – High-throughput in vitro | TAATCSB |
OTX2 | ENSG00000165588 | Homeodomain | Known motif – High-throughput in vitro | HTAATCCB |
OVOL1 | ENSG00000172818 | C2H2 ZF | Known motif – High-throughput in vitro | RNRTAACGGTHH |
OVOL2 | ENSG00000125850 | C2H2 ZF | Known motif – High-throughput in vitro | DNNTARCGGD |
OVOL3 | ENSG00000105261 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
PA2G4 | ENSG00000170515 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
PATZ1 | ENSG00000100105 | C2H2 ZF; AT hook | Known motif – In vivo/Misc source | GGGHGGGG |
PAX1 | ENSG00000125813 | Paired box | Known motif – High-throughput in vitro | SGTCACGCWTSANTGVH |
PAX2 | ENSG00000075891 | Homeodomain; Paired box | Known motif – High-throughput in vitro | SGTCACGCWTSRNTGVNY |
PAX3 | ENSG00000135903 | Homeodomain; Paired box | Known motif – High-throughput in vitro | TAATCRATTA |
PAX4 | ENSG00000106331 | Homeodomain; Paired box | Known motif – High-throughput in vitro | HKAATTAR |
PAX5 | ENSG00000196092 | Paired box | Known motif – High-throughput in vitro | GTYACGSWTSRNTRVNY |
PAX6 | ENSG00000007372 | Homeodomain; Paired box | Known motif – High-throughput in vitro | YACGCHYSRNYRMNY |
PAX7 | ENSG00000009709 | Homeodomain; Paired box | Known motif – High-throughput in vitro | TAATYRATTW |
PAX8 | ENSG00000125618 | Paired box | Known motif – High-throughput in vitro | RNBYRNYSRWGCGTGACS |
PAX9 | ENSG00000198807 | Paired box | Known motif – High-throughput in vitro | SGTCACGCWTSANTGM |
PBX1 | ENSG00000185630 | Homeodomain | Known motif – High-throughput in vitro | TGATKGAYR |
PBX2 | ENSG00000204304 | Homeodomain | Known motif – In vivo/Misc source | KRVHKTGATTGAWK |
PBX3 | ENSG00000167081 | Homeodomain | Known motif – In vivo/Misc source | BBBTGATTGRYND |
PBX4 | ENSG00000105717 | Homeodomain | Known motif – High-throughput in vitro | HDWHH |
PCGF2 | ENSG00000277258 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
PCGF6 | ENSG00000156374 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
PDX1 | ENSG00000139515 | Homeodomain | Known motif – High-throughput in vitro | BTAATKR |
PEG3 | ENSG00000198300 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
PGR | ENSG00000082175 | Nuclear receptor | Known motif – High-throughput in vitro | RGNACRNNNTGTNCH |
PHF1 | ENSG00000112511 | Unknown | Known motif – High-throughput in vitro | |
PHF19 | ENSG00000119403 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
PHF20 | ENSG00000025293 | AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
PHF21A | ENSG00000135365 | AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
PHOX2A | ENSG00000165462 | Homeodomain | Known motif – High-throughput in vitro | TAATTRVRTTA |
PHOX2B | ENSG00000109132 | Homeodomain | Known motif – High-throughput in vitro | TAATTRVRTTA |
PIN1 | ENSG00000127445 | MBD | Likely sequence specific TF according to literature or domain structure – No motif | |
PITX1 | ENSG00000069011 | Homeodomain | Known motif – High-throughput in vitro | HTAATCC |
PITX2 | ENSG00000164093 | Homeodomain | Known motif – High-throughput in vitro | TAAKCC |
PITX3 | ENSG00000107859 | Homeodomain | Known motif – High-throughput in vitro | HTAATCC |
PKNOX1 | ENSG00000160199 | Homeodomain | Known motif – High-throughput in vitro | TGACAGCTGTCA |
PKNOX2 | ENSG00000165495 | Homeodomain | Known motif – High-throughput in vitro | TGACAGSTGTCA |
PLAG1 | ENSG00000181690 | C2H2 ZF | Known motif – High-throughput in vitro | GGGGCCHWMGGGGG |
PLAGL1 | ENSG00000118495 | C2H2 ZF | Known motif – In vivo/Misc source | RGGCCCCCYB |
PLAGL2 | ENSG00000126003 | C2H2 ZF | Known motif – High-throughput in vitro | RGGGGCCC |
PLSCR1 | ENSG00000188313 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
POGK | ENSG00000143157 | Brinker | Likely sequence specific TF according to literature or domain structure – No motif | |
POU1F1 | ENSG00000064835 | Homeodomain; POU | Known motif – High-throughput in vitro | DWTATGCWAATKAD |
POU2AF1 | ENSG00000110777 | Unknown | Known motif – In vivo/Misc source | GATKTGCAKAT |
POU2F1 | ENSG00000143190 | Homeodomain; POU | Known motif – High-throughput in vitro | WTGMATATKYADD |
POU2F2 | ENSG00000028277 | Homeodomain; POU | Known motif – High-throughput in vitro | DTGMATATKYADD |
POU2F3 | ENSG00000137709 | Homeodomain; POU | Known motif – High-throughput in vitro | TATGYWAAT |
POU3F1 | ENSG00000185668 | Homeodomain; POU | Known motif – High-throughput in vitro | WTATGYWAATD |
POU3F2 | ENSG00000184486 | Homeodomain; POU | Known motif – High-throughput in vitro | WTATGYWAATKW |
POU3F3 | ENSG00000198914 | Homeodomain; POU | Known motif – High-throughput in vitro | WWDMWTAWKHAW |
POU3F4 | ENSG00000196767 | Homeodomain; POU | Known motif – High-throughput in vitro | WDAWTTATKCA |
POU4F1 | ENSG00000152192 | Homeodomain; POU | Known motif – High-throughput in vitro | TDMATWATKYA |
POU4F2 | ENSG00000151615 | Homeodomain; POU | Known motif – High-throughput in vitro | BTMATTAAWTATKCA |
POU4F3 | ENSG00000091010 | Homeodomain; POU | Known motif – High-throughput in vitro | RTNMATWATKYAT |
POU5F1 | ENSG00000204531 | Homeodomain; POU | Known motif – High-throughput in vitro | WTATGYWAATKWVB |
POU5F1B | ENSG00000212993 | Homeodomain; POU | Known motif – High-throughput in vitro | TATGYWAAT |
POU5F2 | ENSG00000248483 | Homeodomain; POU | Likely sequence specific TF according to literature or domain structure – No motif | |
POU6F1 | ENSG00000184271 | Homeodomain; POU | Known motif – High-throughput in vitro | MTCATTAH |
POU6F2 | ENSG00000106536 | Homeodomain; POU | Known motif – High-throughput in vitro | DTAATKAGBH |
PPARA | ENSG00000186951 | Nuclear receptor | Known motif – In vivo/Misc source | DAGGTCA |
PPARD | ENSG00000112033 | Nuclear receptor | Known motif – High-throughput in vitro | RRGGTCAAAGGTCA |
PPARG | ENSG00000132170 | Nuclear receptor | Known motif – from protein with 100% identical DBD – in vitro | VNTRMCCYANWDNRACCTWTNVCCYVNW |
PRDM1 | ENSG00000057657 | C2H2 ZF | Known motif – High-throughput in vitro | RAAAGTGAAAGTD |
PRDM10 | ENSG00000170325 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
PRDM12 | ENSG00000130711 | C2H2 ZF | Known motif – In vivo/Misc source | GACAGNTKACC |
PRDM13 | ENSG00000112238 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
PRDM14 | ENSG00000147596 | C2H2 ZF | Known motif – In vivo/Misc source | RSTTAGRGACCY |
PRDM15 | ENSG00000141956 | C2H2 ZF | Known motif – In vivo/Misc source | DTGGAAHTCCMA |
PRDM16 | ENSG00000142611 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | DAGAYAAGATAANM |
PRDM2 | ENSG00000116731 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
PRDM4 | ENSG00000110851 | C2H2 ZF | Known motif – High-throughput in vitro | TTTCAAGGCCCCC |
PRDM5 | ENSG00000138738 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
PRDM6 | ENSG00000061455 | C2H2 ZF | Known motif – In vivo/Misc source | RVARDRRAAADDVWRRAAAA |
PRDM8 | ENSG00000152784 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
PRDM9 | ENSG00000164256 | C2H2 ZF | Known motif – High-throughput in vitro | VGNGGBNRSGGDGGNNNNARVRRV |
PREB | ENSG00000138073 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
PRMT3 | ENSG00000185238 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
PROP1 | ENSG00000175325 | Homeodomain | Known motif – High-throughput in vitro | TAAYYNMATTA |
PROX1 | ENSG00000117707 | Prospero | Known motif – High-throughput in vitro | BAAGACGYCTTV |
PROX2 | ENSG00000119608 | Prospero | Inferred motif from similar protein – High-throughput in vitro | BAMGRCGTCDTV |
PRR12 | ENSG00000126464 | AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
PRRX1 | ENSG00000116132 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
PRRX2 | ENSG00000167157 | Homeodomain | Known motif – High-throughput in vitro | TAATTRV |
PTF1A | ENSG00000168267 | bHLH | Known motif – High-throughput in vitro | VYGTCAGCTGTT |
PURA | ENSG00000185129 | Unknown | Known motif – In vivo/Misc source | CYMBGSCHNCMMMBWCC |
PURB | ENSG00000146676 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
PURG | ENSG00000172733 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
RAG1 | ENSG00000166349 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
RARA | ENSG00000131759 | Nuclear receptor | Known motif – High-throughput in vitro | RRGGTCANV |
RARB | ENSG00000077092 | Nuclear receptor | Known motif – High-throughput in vitro | TGACCYYTTGACCYY |
RARG | ENSG00000172819 | Nuclear receptor | Known motif – High-throughput in vitro | VGGTCA |
RAX | ENSG00000134438 | Homeodomain | Known motif – High-throughput in vitro | HTAATTR |
RAX2 | ENSG00000173976 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
RBAK | ENSG00000146587 | C2H2 ZF | Known motif – High-throughput in vitro | VGDRASRARVRRSV |
RBCK1 | ENSG00000125826 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
RBPJ | ENSG00000168214 | CSL | Known motif – High-throughput in vitro | BTCHCA |
RBPJL | ENSG00000124232 | CSL | Inferred motif from similar protein – In vivo/Misc source | DTTCCCABR |
RBSN | ENSG00000131381 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
REL | ENSG00000162924 | Rel | Known motif – In vivo/Misc source | GGAAWNYCCV |
RELA | ENSG00000173039 | Rel | Known motif – In vivo/Misc source | BKGGAAAKYCCCH |
RELB | ENSG00000104856 | Rel | Known motif – In vivo/Misc source | DKSAAAKYCCCB |
REPIN1 | ENSG00000214022 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
REST | ENSG00000084093 | C2H2 ZF | Known motif – In vivo/Misc source | DTCAGSACCWYGGACAGCDSC |
REXO4 | ENSG00000148300 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
RFX1 | ENSG00000132005 | RFX | Known motif – High-throughput in vitro | BGTTRYCATGRYAACV |
RFX2 | ENSG00000087903 | RFX | Known motif – High-throughput in vitro | BGTTRCCATGGYAACV |
RFX3 | ENSG00000080298 | RFX | Known motif – High-throughput in vitro | BGTTDCCATGGYAAC |
RFX4 | ENSG00000111783 | RFX | Known motif – High-throughput in vitro | GTWRYCATRGHWAC |
RFX5 | ENSG00000143390 | RFX | Known motif – High-throughput in vitro | BGTTGCYATGGYAACV |
RFX6 | ENSG00000185002 | RFX | Inferred motif from similar protein – High-throughput in vitro | GTHDYYNNS |
RFX7 | ENSG00000181827 | RFX | Known motif – High-throughput in vitro | BGTTRCYRY |
RFX8 | ENSG00000196460 | RFX | Likely sequence specific TF according to literature or domain structure – No motif | |
RHOXF1 | ENSG00000101883 | Homeodomain | Known motif – High-throughput in vitro | TRAKCCH |
RHOXF2 | ENSG00000131721 | Homeodomain | Known motif – High-throughput in vitro | TAATCC |
RHOXF2B | ENSG00000203989 | Homeodomain | Inferred motif from similar protein – High-throughput in vitro | TAATCC |
RLF | ENSG00000117000 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
RORA | ENSG00000069667 | Nuclear receptor | Known motif – High-throughput in vitro | MRAGGTCAAVYYVAGGTCA |
RORB | ENSG00000198963 | Nuclear receptor | Known motif – High-throughput in vitro | AWNBRGGTCA |
RORC | ENSG00000143365 | Nuclear receptor | Known motif – High-throughput in vitro | TGMCCYANWTH |
RREB1 | ENSG00000124782 | C2H2 ZF | Known motif – In vivo/Misc source | MCMCMAMMCAMCMMCHMMSV |
RUNX1 | ENSG00000159216 | Runt | Known motif – In vivo/Misc source | VACCACAV |
RUNX2 | ENSG00000124813 | Runt | Known motif – High-throughput in vitro | HRACCRCADWAACCRCAV |
RUNX3 | ENSG00000020633 | Runt | Known motif – High-throughput in vitro | WAACCRCAR |
RXRA | ENSG00000186350 | Nuclear receptor | Known motif – High-throughput in vitro | RRGGTCAAAGGTCA |
RXRB | ENSG00000204231 | Nuclear receptor | Known motif – High-throughput in vitro | RRGGTCAAAGGTCA |
RXRG | ENSG00000143171 | Nuclear receptor | Known motif – High-throughput in vitro | RRGGTCAAAGGTCA |
SAFB | ENSG00000160633 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
SAFB2 | ENSG00000130254 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
SALL1 | ENSG00000103449 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | RYYCAAAAB |
SALL2 | ENSG00000165821 | C2H2 ZF | Known motif – In vivo/Misc source | CCCACCC |
SALL3 | ENSG00000256463 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
SALL4 | ENSG00000101115 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | GCTGATAACAGV |
SATB1 | ENSG00000182568 | CUT; Homeodomain | Known motif – In vivo/Misc source | WKWWWTAAHGRYMNWW |
SATB2 | ENSG00000119042 | CUT; Homeodomain | Inferred motif from similar protein – In vivo/Misc source | WKWWWTAAHGRYMNWW |
SCMH1 | ENSG00000010803 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
SCML4 | ENSG00000146285 | AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
SCRT1 | ENSG00000261678 | C2H2 ZF | Known motif – High-throughput in vitro | KCAACAGGTD |
SCRT2 | ENSG00000215397 | C2H2 ZF | Known motif – High-throughput in vitro | RHGCAACAGGTGB |
SCX | ENSG00000260428 | bHLH | Inferred motif from similar protein – High-throughput in vitro | VCRKMYGB |
SEBOX | ENSG00000274529 | Homeodomain | Inferred motif from similar protein – High-throughput in vitro | HTTAATTA |
SETBP1 | ENSG00000152217 | AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
SETDB1 | ENSG00000143379 | MBD | Known motif – In vivo/Misc source | RACTHCMDYTCCCRKVRDGCHNYG |
SETDB2 | ENSG00000136169 | MBD | Likely sequence specific TF according to literature or domain structure – No motif | |
SGSM2 | ENSG00000141258 | BED ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
SHOX | ENSG00000185960 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
SHOX2 | ENSG00000168779 | Homeodomain | Known motif – High-throughput in vitro | BTAATTR |
SIM1 | ENSG00000112246 | bHLH | Inferred motif from similar protein – In vivo/Misc source | VVNGCACGTMBNS |
SIM2 | ENSG00000159263 | bHLH | Inferred motif from similar protein – In vivo/Misc source | VVNGCACGTMBNS |
SIX1 | ENSG00000126778 | Homeodomain | Known motif – High-throughput in vitro | VBGTATCR |
SIX2 | ENSG00000170577 | Homeodomain | Known motif – High-throughput in vitro | VSGTATCR |
SIX3 | ENSG00000138083 | Homeodomain | Known motif – High-throughput in vitro | VVTATCR |
SIX4 | ENSG00000100625 | Homeodomain | Known motif – High-throughput in vitro | VBGTATCRB |
SIX5 | ENSG00000177045 | Homeodomain | Known motif – In vivo/Misc source | GGAGTTGT |
SIX6 | ENSG00000184302 | Homeodomain | Known motif – High-throughput in vitro | VBSTATCR |
SKI | ENSG00000157933 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
SKIL | ENSG00000136603 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
SKOR1 | ENSG00000188779 | Unknown | Known motif – High-throughput in vitro | WNVKGTAATTAMB |
SKOR2 | ENSG00000215474 | SAND | Known motif – High-throughput in vitro | WNVKGTAATTAA |
SLC2A4RG | ENSG00000125520 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
SMAD1 | ENSG00000170365 | SMAD | Known motif – In vivo/Misc source | DRCAGASAGGSH |
SMAD3 | ENSG00000166949 | SMAD | Known motif – High-throughput in vitro | YGTCTAGACA |
SMAD4 | ENSG00000141646 | SMAD | Known motif – from protein with 100% identical DBD – in vitro | KCYAGACR |
SMAD5 | ENSG00000113658 | SMAD | Known motif – High-throughput in vitro | YGTCTAGACW |
SMAD9 | ENSG00000120693 | SMAD | Known motif – In vivo/Misc source | WGGTCTAGMCMT |
SMYD3 | ENSG00000185420 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
SNAI1 | ENSG00000124216 | C2H2 ZF | Known motif – High-throughput in vitro | VCACCTGY |
SNAI2 | ENSG00000019549 | C2H2 ZF | Known motif – High-throughput in vitro | RRCAGGTGYR |
SNAI3 | ENSG00000185669 | C2H2 ZF | Known motif – High-throughput in vitro | DRCAGGTGYR |
SNAPC2 | ENSG00000104976 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
SNAPC4 | ENSG00000165684 | Myb/SANT | Likely sequence specific TF according to literature or domain structure – No motif | |
SNAPC5 | ENSG00000174446 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
SOHLH1 | ENSG00000165643 | bHLH | Likely sequence specific TF according to literature or domain structure – No motif | |
SOHLH2 | ENSG00000120669 | bHLH | Known motif – High-throughput in vitro | BCACGTGC |
SON | ENSG00000159140 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
SOX1 | ENSG00000182968 | HMG/Sox | Known motif – from protein with 100% identical DBD – in vitro | WBAAW |
SOX10 | ENSG00000100146 | HMG/Sox | Known motif – High-throughput in vitro | DAACAWWGVV |
SOX11 | ENSG00000176887 | HMG/Sox | Known motif – from protein with 100% identical DBD – in vitro | VACAAW |
SOX12 | ENSG00000177732 | HMG/Sox | Known motif – High-throughput in vitro | MCCGAACAAT |
SOX13 | ENSG00000143842 | HMG/Sox | Known motif – from protein with 100% identical DBD – in vitro | RAACAATW |
SOX14 | ENSG00000168875 | HMG/Sox | Known motif – High-throughput in vitro | WCAATR |
SOX15 | ENSG00000129194 | HMG/Sox | Known motif – High-throughput in vitro | ATCAATAMCATTGAT |
SOX17 | ENSG00000164736 | HMG/Sox | Known motif – High-throughput in vitro | DRACAATRV |
SOX18 | ENSG00000203883 | HMG/Sox | Known motif – High-throughput in vitro | ATCAATGHWATTGAT |
SOX2 | ENSG00000181449 | HMG/Sox | Known motif – High-throughput in vitro | HATCAATANCATTGATH |
SOX21 | ENSG00000125285 | HMG/Sox | Known motif – High-throughput in vitro | TCAMTRHCATTGA |
SOX3 | ENSG00000134595 | HMG/Sox | Known motif – High-throughput in vitro | SBNAMAATRB |
SOX30 | ENSG00000039600 | HMG/Sox | Known motif – High-throughput in vitro | RACAAT |
SOX4 | ENSG00000124766 | HMG/Sox | Known motif – High-throughput in vitro | AACAAWGR |
SOX5 | ENSG00000134532 | HMG/Sox | Known motif – High-throughput in vitro | DVACAATRV |
SOX6 | ENSG00000110693 | HMG/Sox | Known motif – High-throughput in vitro | DRACAATRV |
SOX7 | ENSG00000171056 | HMG/Sox | Known motif – High-throughput in vitro | DAACAATKDYAKTGTT |
SOX8 | ENSG00000005513 | HMG/Sox | Known motif – High-throughput in vitro | HATCAATTKCAGTGAT |
SOX9 | ENSG00000125398 | HMG/Sox | Known motif – High-throughput in vitro | DDACAATRV |
SP1 | ENSG00000185591 | C2H2 ZF | Known motif – High-throughput in vitro | RCCMCDCCCMH |
SP100 | ENSG00000067066 | SAND | Likely sequence specific TF according to literature or domain structure – No motif | |
SP110 | ENSG00000135899 | SAND | Likely sequence specific TF according to literature or domain structure – No motif | |
SP140 | ENSG00000079263 | SAND | Likely sequence specific TF according to literature or domain structure – No motif | |
SP140L | ENSG00000185404 | SAND | Likely sequence specific TF according to literature or domain structure – No motif | |
SP2 | ENSG00000167182 | C2H2 ZF | Known motif – High-throughput in vitro | YWAGYCCCGCCCMCYH |
SP3 | ENSG00000172845 | C2H2 ZF | Known motif – High-throughput in vitro | VCCMCRCCCMY |
SP4 | ENSG00000105866 | C2H2 ZF | Known motif – High-throughput in vitro | WRGCCACGCCCMCHY |
SP5 | ENSG00000204335 | C2H2 ZF | Known motif – In vivo/Misc source | ACCVCGCCKCCSS |
SP6 | ENSG00000189120 | C2H2 ZF | Inferred motif from similar protein – High-throughput in vitro | HNGCCACGCCCARK |
SP7 | ENSG00000170374 | C2H2 ZF | Known motif – In vivo/Misc source | VBNSGGGGNGG |
SP8 | ENSG00000164651 | C2H2 ZF | Known motif – High-throughput in vitro | VMCACBCCCMCH |
SP9 | ENSG00000217236 | C2H2 ZF | Known motif – High-throughput in vitro | VMCMCGCCCMYH |
SPDEF | ENSG00000124664 | Ets | Known motif – High-throughput in vitro | AMCCGGATRTD |
SPEN | ENSG00000065526 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
SPI1 | ENSG00000066336 | Ets | Known motif – High-throughput in vitro | RAAAAGMGGAAGTW |
SPIB | ENSG00000269404 | Ets | Known motif – High-throughput in vitro | WWWRVGGAAST |
SPIC | ENSG00000166211 | Ets | Known motif – High-throughput in vitro | RAAWSVGGAAGTM |
SPZ1 | ENSG00000164299 | Unknown | Known motif – In vivo/Misc source | GGSDGWWMCVBHBG |
SRCAP | ENSG00000080603 | AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
SREBF1 | ENSG00000072310 | bHLH | Known motif – High-throughput in vitro | VHCACVCSAY |
SREBF2 | ENSG00000198911 | bHLH | Known motif – High-throughput in vitro | RTCACGTGAY |
SRF | ENSG00000112658 | MADS box | Known motif – High-throughput in vitro | DCCWTATATGGT |
SRY | ENSG00000184895 | HMG/Sox | Known motif – High-throughput in vitro | AACAATGNTATTGTT |
ST18 | ENSG00000147488 | C2H2 ZF | Inferred motif from similar protein – High-throughput in vitro | VAAGTTT |
STAT1 | ENSG00000115415 | STAT | Known motif – In vivo/Misc source | HTTCCYRGAAR |
STAT2 | ENSG00000170581 | STAT | Known motif – In vivo/Misc source | TNRGTTTCDNTTYC |
STAT3 | ENSG00000168610 | STAT | Known motif – In vivo/Misc source | HTTCCYRKMA |
STAT4 | ENSG00000138378 | STAT | Known motif – In vivo/Misc source | BDHTTCTBGKAAD |
STAT5A | ENSG00000126561 | STAT | Known motif – In vivo/Misc source | YTTCYNRGAAHY |
STAT5B | ENSG00000173757 | STAT | Known motif – In vivo/Misc source | ADTTCYHRGAAA |
STAT6 | ENSG00000166888 | STAT | Known motif – In vivo/Misc source | DWTTYCNDDGAA |
T | ENSG00000164458 | T-box | Known motif – High-throughput in vitro | ANGTGYGAHWWNTVRCACCT |
TAL1 | ENSG00000162367 | bHLH | Known motif – In vivo/Misc source | RNCAGVTGGH |
TAL2 | ENSG00000186051 | bHLH | Inferred motif from similar protein – In vivo/Misc source | RNCAGVTGGH |
TBP | ENSG00000112592 | TBP | Known motif – from protein with 100% identical DBD – in vitro | WWWWAW |
TBPL1 | ENSG00000028839 | TBP | Likely sequence specific TF according to literature or domain structure – No motif | |
TBPL2 | ENSG00000182521 | TBP | Inferred motif from similar protein – High-throughput in vitro | WWWWAW |
TBR1 | ENSG00000136535 | T-box | Known motif – High-throughput in vitro | TTCACACCT |
TBX1 | ENSG00000184058 | T-box | Known motif – High-throughput in vitro | TCACACCT |
TBX10 | ENSG00000167800 | T-box | Inferred motif from similar protein – High-throughput in vitro | BYTCACACCYHV |
TBX15 | ENSG00000092607 | T-box | Known motif – High-throughput in vitro | TCACACCT |
TBX18 | ENSG00000112837 | T-box | Known motif – High-throughput in vitro | BYTCACACCTHH |
TBX19 | ENSG00000143178 | T-box | Known motif – High-throughput in vitro | TMRCACNTABGTGYBAH |
TBX2 | ENSG00000121068 | T-box | Known motif – High-throughput in vitro | VRCRC |
TBX20 | ENSG00000164532 | T-box | Known motif – High-throughput in vitro | TCACRCBYTMACACCT |
TBX21 | ENSG00000073861 | T-box | Known motif – High-throughput in vitro | WTCACACCTH |
TBX22 | ENSG00000122145 | T-box | Known motif – In vivo/Misc source | AGGTGWSAAWTTCACACCT |
TBX3 | ENSG00000135111 | T-box | Known motif – High-throughput in vitro | YVACACSH |
TBX4 | ENSG00000121075 | T-box | Known motif – High-throughput in vitro | TVACACCT |
TBX5 | ENSG00000089225 | T-box | Known motif – High-throughput in vitro | TVACACCT |
TBX6 | ENSG00000149922 | T-box | Known motif – High-throughput in vitro | TVACACSY |
TCF12 | ENSG00000140262 | bHLH | Known motif – High-throughput in vitro | VCACSTGB |
TCF15 | ENSG00000125878 | bHLH | Inferred motif from similar protein – High-throughput in vitro | VCRKMYGB |
TCF20 | ENSG00000100207 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
TCF21 | ENSG00000118526 | bHLH | Known motif – High-throughput in vitro | RVCAGCTGTTV |
TCF23 | ENSG00000163792 | bHLH | Inferred motif from similar protein – High-throughput in vitro | VCRKMYGB |
TCF24 | ENSG00000261787 | bHLH | Inferred motif from similar protein – High-throughput in vitro | RMCAKMTGK |
TCF3 | ENSG00000071564 | bHLH | Known motif – High-throughput in vitro | VCAGGTGB |
TCF4 | ENSG00000196628 | bHLH | Known motif – High-throughput in vitro | HRCACCTGB |
TCF7 | ENSG00000081059 | HMG/Sox | Known motif – High-throughput in vitro | DSATCAAWS |
TCF7L1 | ENSG00000152284 | HMG/Sox | Known motif – High-throughput in vitro | AAAGATCAAAGG |
TCF7L2 | ENSG00000148737 | HMG/Sox | Known motif – from protein with 100% identical DBD – in vitro | SWTCAAAV |
TCFL5 | ENSG00000101190 | bHLH | Known motif – High-throughput in vitro | KCRCGCGCHC |
TEAD1 | ENSG00000187079 | TEA | Known motif – High-throughput in vitro | RCATTCCDH |
TEAD2 | ENSG00000074219 | TEA | Known motif – High-throughput in vitro | YRCATTCCW |
TEAD3 | ENSG00000007866 | TEA | Known motif – High-throughput in vitro | RCATTCYDNDCATWCCD |
TEAD4 | ENSG00000197905 | TEA | Known motif – High-throughput in vitro | RMATTCYD |
TEF | ENSG00000167074 | bZIP | Known motif – High-throughput in vitro | VTTACRTAAB |
TERB1 | ENSG00000249961 | Myb/SANT | Likely sequence specific TF according to literature or domain structure – No motif | |
TERF1 | ENSG00000147601 | Myb/SANT | Likely sequence specific TF according to literature or domain structure – No motif | |
TERF2 | ENSG00000132604 | Myb/SANT | Inferred motif from similar protein – High-throughput in vitro | AACCCTAV |
TET1 | ENSG00000138336 | CxxC | Known motif – High-throughput in vitro | HVCGH |
TET2 | ENSG00000168769 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
TET3 | ENSG00000187605 | CxxC | Likely sequence specific TF according to literature or domain structure – No motif | |
TFAP2A | ENSG00000137203 | AP-2 | Known motif – High-throughput in vitro | HSCCYBVRGGCD |
TFAP2B | ENSG00000008196 | AP-2 | Known motif – High-throughput in vitro | SCCBNVGGS |
TFAP2C | ENSG00000087510 | AP-2 | Known motif – High-throughput in vitro | HGCCYBVRGGSD |
TFAP2D | ENSG00000008197 | AP-2 | Known motif – In vivo/Misc source | RCGNGCCBCRGVCB |
TFAP2E | ENSG00000116819 | AP-2 | Known motif – High-throughput in vitro | HSCCYSRGGSD |
TFAP4 | ENSG00000090447 | bHLH | Known motif – High-throughput in vitro | VWCAGCTGWB |
TFCP2 | ENSG00000135457 | Grainyhead | Known motif – High-throughput in vitro | WCCGGWWHDAWCYGGW |
TFCP2L1 | ENSG00000115112 | Grainyhead | Known motif – High-throughput in vitro | DCYRGHNNNDDCYRGH |
TFDP1 | ENSG00000198176 | E2F | Known motif – In vivo/Misc source | DYYTCSCGCYMWWY |
TFDP2 | ENSG00000114126 | E2F | Inferred motif from similar protein – In vivo/Misc source | DYYTCSCGCYMWWY |
TFDP3 | ENSG00000183434 | E2F | Inferred motif from similar protein – In vivo/Misc source | DYYTCSCGCYMWWY |
TFE3 | ENSG00000068323 | bHLH | Known motif – High-throughput in vitro | RKCACGTGNB |
TFEB | ENSG00000112561 | bHLH | Known motif – High-throughput in vitro | RNCACGTGAY |
TFEC | ENSG00000105967 | bHLH | Known motif – High-throughput in vitro | RNCACRTGAB |
TGIF1 | ENSG00000177426 | Homeodomain | Known motif – High-throughput in vitro | TGACAGCTGTCA |
TGIF2 | ENSG00000118707 | Homeodomain | Known motif – High-throughput in vitro | TGACABVTGTCA |
TGIF2LX | ENSG00000153779 | Homeodomain | Known motif – High-throughput in vitro | TGACASSTGTCA |
TGIF2LY | ENSG00000176679 | Homeodomain | Known motif – High-throughput in vitro | TGACABVTGTCA |
THAP1 | ENSG00000131931 | THAP finger | Known motif – In vivo/Misc source | BYYGCCMKNANYMAAVATGGCSV |
THAP10 | ENSG00000129028 | THAP finger | Likely sequence specific TF according to literature or domain structure – No motif | |
THAP11 | ENSG00000168286 | THAP finger | Likely sequence specific TF according to literature or domain structure – No motif | |
THAP12 | ENSG00000137492 | THAP finger | Known motif – High-throughput in vitro | YMBNNBGR |
THAP2 | ENSG00000173451 | THAP finger | Likely sequence specific TF according to literature or domain structure – No motif | |
THAP3 | ENSG00000041988 | THAP finger | Likely sequence specific TF according to literature or domain structure – No motif | |
THAP4 | ENSG00000176946 | THAP finger | Likely sequence specific TF according to literature or domain structure – No motif | |
THAP5 | ENSG00000177683 | THAP finger | Likely sequence specific TF according to literature or domain structure – No motif | |
THAP6 | ENSG00000174796 | THAP finger | Likely sequence specific TF according to literature or domain structure – No motif | |
THAP7 | ENSG00000184436 | THAP finger | Likely sequence specific TF according to literature or domain structure – No motif | |
THAP8 | ENSG00000161277 | THAP finger | Likely sequence specific TF according to literature or domain structure – No motif | |
THAP9 | ENSG00000168152 | THAP finger | Likely sequence specific TF according to literature or domain structure – No motif | |
THRA | ENSG00000126351 | Nuclear receptor | Known motif – High-throughput in vitro | DTGACCTBATRAGGTCAH |
THRB | ENSG00000151090 | Nuclear receptor | Known motif – High-throughput in vitro | TGWCCTBRNYVAGGWCA |
THYN1 | ENSG00000151500 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
TIGD1 | ENSG00000221944 | CENPB | Known motif – High-throughput in vitro | SCGCAATA |
TIGD2 | ENSG00000180346 | CENPB | Inferred motif from similar protein – High-throughput in vitro | RCGGWWR |
TIGD3 | ENSG00000173825 | CENPB | Likely sequence specific TF according to literature or domain structure – No motif | |
TIGD4 | ENSG00000169989 | CENPB | Likely sequence specific TF according to literature or domain structure – No motif | |
TIGD5 | ENSG00000179886 | CENPB | Likely sequence specific TF according to literature or domain structure – No motif | |
TIGD6 | ENSG00000164296 | CENPB | Inferred motif from similar protein – High-throughput in vitro | WVCRWA |
TIGD7 | ENSG00000140993 | CENPB | Likely sequence specific TF according to literature or domain structure – No motif | |
TLX1 | ENSG00000107807 | Homeodomain | Known motif – In vivo/Misc source | VCHHVTTRVCV |
TLX2 | ENSG00000115297 | Homeodomain | Known motif – High-throughput in vitro | BTAATTR |
TLX3 | ENSG00000164438 | Homeodomain | Known motif – High-throughput in vitro | AATKGNNNNNNNNNNNNNCAATT |
TMF1 | ENSG00000144747 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
TOPORS | ENSG00000197579 | Unknown | Known motif – In vivo/Misc source | TCCCAGCTACTTTGGGA |
TP53 | ENSG00000141510 | p53 | Known motif – In vivo/Misc source | DRCATGYYBRGRCATGYCY |
TP63 | ENSG00000073282 | p53 | Known motif – High-throughput in vitro | DACATGTYVYRACATGTY |
TP73 | ENSG00000078900 | p53 | Known motif – In vivo/Misc source | DRRCAWGYHCWGRCWTGYH |
TPRX1 | ENSG00000178928 | Homeodomain | Likely sequence specific TF according to literature or domain structure – No motif | |
TRAFD1 | ENSG00000135148 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
TRERF1 | ENSG00000124496 | C2H2 ZF; Myb/SANT | Inferred motif from similar protein – In vivo/Misc source | AGACKTTAGTCA |
TRPS1 | ENSG00000104447 | GATA | Known motif – In vivo/Misc source | HWSRARATAGWDDMH |
TSC22D1 | ENSG00000102804 | Unknown | Likely sequence specific TF according to literature or domain structure – No motif | |
TSHZ1 | ENSG00000179981 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
TSHZ2 | ENSG00000182463 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
TSHZ3 | ENSG00000121297 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
TTF1 | ENSG00000125482 | Myb/SANT | Likely sequence specific TF according to literature or domain structure – No motif | |
TWIST1 | ENSG00000122691 | bHLH | Known motif – In vivo/Misc source | MHVCACHTGSD |
TWIST2 | ENSG00000233608 | bHLH | Known motif – from protein with 100% identical DBD – in vitro | MCATATGT |
UBP1 | ENSG00000153560 | Grainyhead | Known motif – High-throughput in vitro | DCYRGHNNNNDCYRGH |
UNCX | ENSG00000164853 | Homeodomain | Known motif – High-throughput in vitro | TAATTR |
USF1 | ENSG00000158773 | bHLH | Known motif – High-throughput in vitro | RNCACGTGRY |
USF2 | ENSG00000105698 | bHLH | Known motif – High-throughput in vitro | VCACGTGVC |
USF3 | ENSG00000176542 | bHLH | Likely sequence specific TF according to literature or domain structure – No motif | |
VAX1 | ENSG00000148704 | Homeodomain | Known motif – High-throughput in vitro | YTAATKA |
VAX2 | ENSG00000116035 | Homeodomain | Known motif – High-throughput in vitro | YTAATKA |
VDR | ENSG00000111424 | Nuclear receptor | Known motif – High-throughput in vitro | TGAACYCDRTGAACYC |
VENTX | ENSG00000151650 | Homeodomain | Known motif – High-throughput in vitro | VNTAATBR |
VEZF1 | ENSG00000136451 | C2H2 ZF | Known motif – High-throughput in vitro | RKGGGGGG |
VSX1 | ENSG00000100987 | Homeodomain | Known motif – High-throughput in vitro | TAATTRS |
VSX2 | ENSG00000119614 | Homeodomain | Known motif – High-throughput in vitro | YTAATTA |
WIZ | ENSG00000011451 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
WT1 | ENSG00000184937 | C2H2 ZF | Known motif – High-throughput in vitro | BGGGGGRG |
XBP1 | ENSG00000100219 | bZIP | Known motif – High-throughput in vitro | GVTGACGTGKCVHW |
XPA | ENSG00000136936 | Unknown | Known motif – High-throughput in vitro | VCACCTCACMY |
YBX1 | ENSG00000065978 | CSD | Known motif – High-throughput in vitro | YGTWCCAYC |
YBX2 | ENSG00000006047 | CSD | Inferred motif from similar protein – High-throughput in vitro | YGTWCCAYC |
YBX3 | ENSG00000060138 | CSD | Known motif – from protein with 100% identical DBD – in vitro | YGTWCCAYC |
YY1 | ENSG00000100811 | C2H2 ZF | Known motif – High-throughput in vitro | HRWNATGGCB |
YY2 | ENSG00000230797 | C2H2 ZF | Known motif – High-throughput in vitro | DDNATGGCGG |
ZBED1 | ENSG00000214717 | BED ZF | Known motif – High-throughput in vitro | YATGTCGCGAYAD |
ZBED2 | ENSG00000177494 | BED ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBED3 | ENSG00000132846 | BED ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBED4 | ENSG00000100426 | BED ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBED5 | ENSG00000236287 | BED ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBED6 | ENSG00000257315 | BED ZF | Inferred motif from similar protein – In vivo/Misc source | VVRGCGAGCYYV |
ZBED9 | ENSG00000232040 | BED ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB1 | ENSG00000126804 | C2H2 ZF | Known motif – from protein with 100% identical DBD – in vitro | HMMCGCRH |
ZBTB10 | ENSG00000205189 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB11 | ENSG00000066422 | C2H2 ZF | Known motif – In vivo/Misc source | GGGGKGCRCMCA |
ZBTB12 | ENSG00000204366 | C2H2 ZF | Known motif – High-throughput in vitro | CTAGAACMB |
ZBTB14 | ENSG00000198081 | C2H2 ZF | Known motif – High-throughput in vitro | VDCGTGCACGCGCRH |
ZBTB16 | ENSG00000109906 | C2H2 ZF | Known motif – In vivo/Misc source | BTVNWYBKVHKBTAAADYWKKRHYWRDKY |
ZBTB17 | ENSG00000116809 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB18 | ENSG00000179456 | C2H2 ZF | Known motif – High-throughput in vitro | DKCCAGATGTK |
ZBTB2 | ENSG00000181472 | C2H2 ZF | Known motif – High-throughput in vitro | DKWACCGGRA |
ZBTB20 | ENSG00000181722 | C2H2 ZF | Known motif – High-throughput in vitro | VYATACRTYV |
ZBTB21 | ENSG00000173276 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB22 | ENSG00000236104 | C2H2 ZF | Known motif – High-throughput in vitro | HKCACWAYNRTWGTGMD |
ZBTB24 | ENSG00000112365 | C2H2 ZF; AT hook | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB25 | ENSG00000089775 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB26 | ENSG00000171448 | C2H2 ZF | Known motif – High-throughput in vitro | DHTCYAGAAHR |
ZBTB3 | ENSG00000185670 | C2H2 ZF | Known motif – from protein with 100% identical DBD – in vitro | DSCAGYK |
ZBTB32 | ENSG00000011590 | C2H2 ZF | Known motif – High-throughput in vitro | HGTACAGTRWYACTGTACD |
ZBTB33 | ENSG00000177485 | C2H2 ZF | Known motif – In vivo/Misc source | SVNTCTCGCGAGANB |
ZBTB34 | ENSG00000177125 | C2H2 ZF | Inferred motif from similar protein – High-throughput in vitro | DTCGGCYAABDCGGCA |
ZBTB37 | ENSG00000185278 | C2H2 ZF | Known motif – High-throughput in vitro | DTCGGCYAABDCGGCA |
ZBTB38 | ENSG00000177311 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB39 | ENSG00000166860 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB4 | ENSG00000174282 | C2H2 ZF | Known motif – In vivo/Misc source | CVCHAHCRCYMTBG |
ZBTB40 | ENSG00000184677 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB41 | ENSG00000177888 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB42 | ENSG00000179627 | C2H2 ZF | Known motif – High-throughput in vitro | MRCAKCTGS |
ZBTB43 | ENSG00000169155 | C2H2 ZF | Known motif – High-throughput in vitro | GTGCTRNNNNNDDGGCAC |
ZBTB44 | ENSG00000196323 | C2H2 ZF | Known motif – High-throughput in vitro | RMTGCAKB |
ZBTB45 | ENSG00000119574 | C2H2 ZF | Known motif – High-throughput in vitro | BMTATAGGBR |
ZBTB46 | ENSG00000130584 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB47 | ENSG00000114853 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB48 | ENSG00000204859 | C2H2 ZF | Known motif – In vivo/Misc source | YHAGGGANHDD |
ZBTB49 | ENSG00000168826 | C2H2 ZF | Known motif – High-throughput in vitro | TGACVBGYCARGCRRAA |
ZBTB5 | ENSG00000168795 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB6 | ENSG00000186130 | C2H2 ZF | Known motif – In vivo/Misc source | VGRTGMTRGAGCC |
ZBTB7A | ENSG00000178951 | C2H2 ZF | Known motif – High-throughput in vitro | RCGACCACCNV |
ZBTB7B | ENSG00000160685 | C2H2 ZF | Known motif – High-throughput in vitro | DCGACCMCCVA |
ZBTB7C | ENSG00000184828 | C2H2 ZF | Known motif – High-throughput in vitro | DCRACCACCVH |
ZBTB8A | ENSG00000160062 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB8B | ENSG00000273274 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZBTB9 | ENSG00000213588 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZC3H8 | ENSG00000144161 | CCCH ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZEB1 | ENSG00000148516 | C2H2 ZF; Homeodomain | Known motif – In vivo/Misc source | CAGGTGNR |
ZEB2 | ENSG00000169554 | C2H2 ZF; Homeodomain | Inferred motif from similar protein – In vivo/Misc source | CAGGTGNR |
ZFAT | ENSG00000066827 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZFHX2 | ENSG00000136367 | Homeodomain | Known motif – High-throughput in vitro | TRATYA |
ZFHX3 | ENSG00000140836 | C2H2 ZF; Homeodomain | Known motif – High-throughput in vitro | RMTND |
ZFHX4 | ENSG00000091656 | C2H2 ZF; Homeodomain | Inferred motif from similar protein – In vivo/Misc source | WAATWAWTAAY |
ZFP1 | ENSG00000184517 | C2H2 ZF | Known motif – High-throughput in vitro | TDYBATACCCANHH |
ZFP14 | ENSG00000142065 | C2H2 ZF | Known motif – High-throughput in vitro | GGAGSHHHHDGARHK |
ZFP2 | ENSG00000198939 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | RGRAAVYGAAACT |
ZFP28 | ENSG00000196867 | C2H2 ZF | Known motif – High-throughput in vitro | AYMNHWRARGAAAHDGARMKVHHDNDNNDNNH |
ZFP3 | ENSG00000180787 | C2H2 ZF | Known motif – High-throughput in vitro | GGNTGNRTAGGAGYTYDB |
ZFP30 | ENSG00000120784 | C2H2 ZF | Inferred motif from similar protein – High-throughput in vitro | RAHRNRGYTRNRDRNRG |
ZFP37 | ENSG00000136866 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZFP41 | ENSG00000181638 | C2H2 ZF | Known motif – High-throughput in vitro | RYGGAGAGTTAGC |
ZFP42 | ENSG00000179059 | C2H2 ZF | Known motif – High-throughput in vitro | CAAKATGGCBGHC |
ZFP57 | ENSG00000204644 | C2H2 ZF | Known motif – In vivo/Misc source | SNNVNNVBTGCCGCV |
ZFP62 | ENSG00000196670 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZFP64 | ENSG00000020256 | C2H2 ZF | Known motif – In vivo/Misc source | VGGRSCCCGGGVVNS |
ZFP69 | ENSG00000187815 | C2H2 ZF | Known motif – High-throughput in vitro | GWGRCTRGAWAC |
ZFP69B | ENSG00000187801 | C2H2 ZF | Known motif – High-throughput in vitro | GTGGCTGGARVV |
ZFP82 | ENSG00000181007 | C2H2 ZF | Known motif – High-throughput in vitro | AGAATTAGTRAAYTGGAARAY |
ZFP90 | ENSG00000184939 | C2H2 ZF | Known motif – High-throughput in vitro | RYACTGCTTTWG |
ZFP91 | ENSG00000186660 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZFP92 | ENSG00000189420 | C2H2 ZF | Known motif – In vivo/Misc source | MGATAAAAKGM |
ZFPM1 | ENSG00000179588 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZFPM2 | ENSG00000169946 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZFX | ENSG00000005889 | C2H2 ZF | Known motif – In vivo/Misc source | VVSVSBNBBAGGCCBVGSH |
ZFY | ENSG00000067646 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | BAGGCCBVGSYBVV |
ZGLP1 | ENSG00000220201 | GATA | Likely sequence specific TF according to literature or domain structure – No motif | |
ZGPAT | ENSG00000197114 | CCCH ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZHX1 | ENSG00000165156 | Homeodomain | Known motif – High-throughput in vitro | DYB |
ZHX2 | ENSG00000178764 | Homeodomain | Likely sequence specific TF according to literature or domain structure – No motif | |
ZHX3 | ENSG00000174306 | Homeodomain | Likely sequence specific TF according to literature or domain structure – No motif | |
ZIC1 | ENSG00000152977 | C2H2 ZF | Known motif – High-throughput in vitro | DCRCAGCRGGGGGBV |
ZIC2 | ENSG00000043355 | C2H2 ZF | Known motif – from protein with 100% identical DBD – in vitro | YNRBRKG |
ZIC3 | ENSG00000156925 | C2H2 ZF | Known motif – High-throughput in vitro | KCACAGCRGGGGGTCB |
ZIC4 | ENSG00000174963 | C2H2 ZF | Known motif – High-throughput in vitro | DCNCHRCRGGGGGYM |
ZIC5 | ENSG00000139800 | C2H2 ZF | Known motif – High-throughput in vitro | DCDCAGCGGGGGGTM |
ZIK1 | ENSG00000171649 | C2H2 ZF | Known motif – High-throughput in vitro | RDRRCAAWRGCAMNRVRWNNB |
ZIM2 | ENSG00000269699 | C2H2 ZF | Known motif – In vivo/Misc source | YCNBSYBSCYTYYYCHBCCVGCCYGKGGYY |
ZIM3 | ENSG00000141946 | C2H2 ZF | Known motif – High-throughput in vitro | RNHAACAGAAANCYM |
ZKSCAN1 | ENSG00000106261 | C2H2 ZF | Known motif – High-throughput in vitro | CCTACTAHGH |
ZKSCAN2 | ENSG00000155592 | C2H2 ZF | Known motif – High-throughput in vitro | RRRRRMMAC |
ZKSCAN3 | ENSG00000189298 | C2H2 ZF | Known motif – High-throughput in vitro | TCGAGGYTAGMCCA |
ZKSCAN4 | ENSG00000187626 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZKSCAN5 | ENSG00000196652 | C2H2 ZF | Known motif – High-throughput in vitro | DGGAGGTGA |
ZKSCAN7 | ENSG00000196345 | C2H2 ZF | Known motif – High-throughput in vitro | VYAHACTKTNRAGYGV |
ZKSCAN8 | ENSG00000198315 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZMAT1 | ENSG00000166432 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZMAT4 | ENSG00000165061 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF10 | ENSG00000256223 | C2H2 ZF | Known motif – High-throughput in vitro | TGAGGT |
ZNF100 | ENSG00000197020 | C2H2 ZF | Known motif – High-throughput in vitro | VBRNGGCGGCGGCNB |
ZNF101 | ENSG00000181896 | C2H2 ZF | Known motif – High-throughput in vitro | VDGYKGCCCCHGTRTCH |
ZNF107 | ENSG00000196247 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF112 | ENSG00000062370 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF114 | ENSG00000178150 | C2H2 ZF | Known motif – In vivo/Misc source | VSSSBSBVVSSBSSSSYHTWTATABVSB |
ZNF117 | ENSG00000152926 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | GKGCWGCAGM |
ZNF12 | ENSG00000164631 | C2H2 ZF | Known motif – High-throughput in vitro | VYGCKRTAACAARYAKSMCC |
ZNF121 | ENSG00000197961 | C2H2 ZF | Known motif – High-throughput in vitro | VCDGGVCMRVDBWGYVNGRYCCH |
ZNF124 | ENSG00000196418 | C2H2 ZF | Known motif – High-throughput in vitro | AAGAAGGCTTTAATYRGG |
ZNF131 | ENSG00000172262 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF132 | ENSG00000131849 | C2H2 ZF | Known motif – High-throughput in vitro | VRGGARRGNRGGARG |
ZNF133 | ENSG00000125846 | C2H2 ZF | Known motif – High-throughput in vitro | DGRNMCAAMWNANGTAHAAKTGGHDNH |
ZNF134 | ENSG00000213762 | C2H2 ZF | Known motif – High-throughput in vitro | VYTMAKCAGKKGMNG |
ZNF135 | ENSG00000176293 | C2H2 ZF | Known motif – High-throughput in vitro | HHYTGAGGTYGAGCY |
ZNF136 | ENSG00000196646 | C2H2 ZF | Known motif – High-throughput in vitro | TTCTTGGTTGRCAGKTTT |
ZNF138 | ENSG00000197008 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF14 | ENSG00000105708 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF140 | ENSG00000196387 | C2H2 ZF | Known motif – High-throughput in vitro | GAGCGGAATTGYH |
ZNF141 | ENSG00000131127 | C2H2 ZF | Known motif – High-throughput in vitro | RVKGRGRGYGKCCCCC |
ZNF142 | ENSG00000115568 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF143 | ENSG00000166478 | C2H2 ZF | Known motif – High-throughput in vitro | YWCCCAYAATGCAYYG |
ZNF146 | ENSG00000167635 | C2H2 ZF | Known motif – High-throughput in vitro | GGARTAYTABDCAGC |
ZNF148 | ENSG00000163848 | C2H2 ZF | Known motif – In vivo/Misc source | DGKGGGRGGD |
ZNF154 | ENSG00000179909 | C2H2 ZF | Known motif – High-throughput in vitro | TGTCTAGTARRTCYD |
ZNF155 | ENSG00000204920 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF157 | ENSG00000147117 | C2H2 ZF | Known motif – High-throughput in vitro | KNNDNGYRYAYTGHWDNCCYYVCCADGHCH |
ZNF16 | ENSG00000170631 | C2H2 ZF | Known motif – High-throughput in vitro | GAGCCAYDGMRGGYKBTD |
ZNF160 | ENSG00000170949 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF165 | ENSG00000197279 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF169 | ENSG00000175787 | C2H2 ZF | Known motif – High-throughput in vitro | CTCCCT |
ZNF17 | ENSG00000186272 | C2H2 ZF | Known motif – High-throughput in vitro | VNBNNNNNSTKYMTGYTCHKGNNNV |
ZNF174 | ENSG00000103343 | C2H2 ZF | Known motif – High-throughput in vitro | GSCRAGTGAYYGNC |
ZNF175 | ENSG00000105497 | C2H2 ZF | Known motif – In vivo/Misc source | CYAYACAHRAYAADGAATACA |
ZNF177 | ENSG00000188629 | C2H2 ZF | Known motif – High-throughput in vitro | BTYGRTCKMRNKKNNVAGTCATD |
ZNF18 | ENSG00000154957 | C2H2 ZF | Known motif – High-throughput in vitro | SNRTTCACACY |
ZNF180 | ENSG00000167384 | C2H2 ZF | Known motif – High-throughput in vitro | VGGGVSNGGNGGSGRSBGSGGCVV |
ZNF181 | ENSG00000197841 | C2H2 ZF | Known motif – High-throughput in vitro | VYYYSWGSTWSTNGGRMKGMKGHB |
ZNF182 | ENSG00000147118 | C2H2 ZF | Known motif – High-throughput in vitro | AAAAMMAAAARMAAA |
ZNF184 | ENSG00000096654 | C2H2 ZF | Known motif – High-throughput in vitro | TGGWGARGA |
ZNF189 | ENSG00000136870 | C2H2 ZF | Known motif – High-throughput in vitro | VDGGAASRGMVDNDS |
ZNF19 | ENSG00000157429 | C2H2 ZF | Known motif – High-throughput in vitro | DRGGVBHHDGACRNNDV |
ZNF195 | ENSG00000005801 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF197 | ENSG00000186448 | C2H2 ZF | Known motif – High-throughput in vitro | RRRGWCARRRRVVVR |
ZNF2 | ENSG00000275111 | C2H2 ZF | Known motif – High-throughput in vitro | SCVCVGVGCYGCGC |
ZNF20 | ENSG00000132010 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF200 | ENSG00000010539 | C2H2 ZF | Known motif – High-throughput in vitro | BVNVSCGGAAGY |
ZNF202 | ENSG00000166261 | C2H2 ZF | Known motif – In vivo/Misc source | CSCNBCYYCCDCYBCYBSBBCSBSBSCYB |
ZNF205 | ENSG00000122386 | C2H2 ZF | Known motif – In vivo/Misc source | TGGAAT |
ZNF207 | ENSG00000010244 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF208 | ENSG00000160321 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF211 | ENSG00000121417 | C2H2 ZF | Known motif – High-throughput in vitro | HNYATATACCAB |
ZNF212 | ENSG00000170260 | C2H2 ZF | Known motif – In vivo/Misc source | CACACAHVHMCACRC |
ZNF213 | ENSG00000085644 | C2H2 ZF | Known motif – High-throughput in vitro | MGAMMBCRGGCGGMG |
ZNF214 | ENSG00000149050 | C2H2 ZF | Known motif – High-throughput in vitro | VWTMATYAANRTCCTCAAVAABD |
ZNF215 | ENSG00000149054 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF217 | ENSG00000171940 | C2H2 ZF | Known motif – In vivo/Misc source | GKNRGAAT |
ZNF219 | ENSG00000165804 | C2H2 ZF | Known motif – In vivo/Misc source | DGGGGGGYGGW |
ZNF22 | ENSG00000165512 | C2H2 ZF | Known motif – High-throughput in vitro | AAAAAAAAA |
ZNF221 | ENSG00000159905 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF222 | ENSG00000159885 | C2H2 ZF | Known motif – High-throughput in vitro | GCTGMSAYB |
ZNF223 | ENSG00000178386 | C2H2 ZF | Known motif – In vivo/Misc source | MCACACASASM |
ZNF224 | ENSG00000267680 | C2H2 ZF | Known motif – High-throughput in vitro | WMCYYNKGDGYHMHRKGRMTY |
ZNF225 | ENSG00000256294 | C2H2 ZF | Known motif – In vivo/Misc source | TTAYCWKYDKNRYTTYTTTYTTTTTYYH |
ZNF226 | ENSG00000167380 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF227 | ENSG00000131115 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF229 | ENSG00000278318 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF23 | ENSG00000167377 | C2H2 ZF | Known motif – High-throughput in vitro | DCRMCCATGGCCGCGHCM |
ZNF230 | ENSG00000159882 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF232 | ENSG00000167840 | C2H2 ZF | Known motif – High-throughput in vitro | RTGTTAAAYGTRGATTAAS |
ZNF233 | ENSG00000159915 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF234 | ENSG00000263002 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF235 | ENSG00000159917 | C2H2 ZF | Known motif – High-throughput in vitro | AARARADRAARRAAAWNRDDWDVDNNAWDR |
ZNF236 | ENSG00000130856 | C2H2 ZF | Known motif – In vivo/Misc source | MGTAATATTVM |
ZNF239 | ENSG00000196793 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF24 | ENSG00000172466 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF248 | ENSG00000198105 | C2H2 ZF | Known motif – High-throughput in vitro | RHDDACHATRTYCAKBRA |
ZNF25 | ENSG00000175395 | C2H2 ZF | Known motif – In vivo/Misc source | WGAADWANAVARGTYGCWGCATTTAGAAA |
ZNF250 | ENSG00000196150 | C2H2 ZF | Known motif – High-throughput in vitro | YASGCCYAY |
ZNF251 | ENSG00000198169 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF253 | ENSG00000256771 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF254 | ENSG00000213096 | C2H2 ZF | Known motif – High-throughput in vitro | ACTGGCYTAGCCTCCCAGCCTACATCTTTCTCC |
ZNF256 | ENSG00000152454 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF257 | ENSG00000197134 | C2H2 ZF | Known motif – High-throughput in vitro | GAGGMRA |
ZNF26 | ENSG00000198393 | C2H2 ZF | Known motif – In vivo/Misc source | ATTTTT |
ZNF260 | ENSG00000254004 | C2H2 ZF | Known motif – High-throughput in vitro | GGARDRVDANRVDRV |
ZNF263 | ENSG00000006194 | C2H2 ZF | Known motif – High-throughput in vitro | GGGAGSACB |
ZNF264 | ENSG00000083844 | C2H2 ZF | Known motif – High-throughput in vitro | KKGRGSCCYYHNBRATGGGATTAGTGCCCT |
ZNF266 | ENSG00000174652 | C2H2 ZF | Known motif – High-throughput in vitro | VNHRCTCACAGSYCC |
ZNF267 | ENSG00000185947 | C2H2 ZF | Known motif – High-throughput in vitro | VSYNVVGGCNKGBGVRGVDG |
ZNF268 | ENSG00000090612 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF273 | ENSG00000198039 | C2H2 ZF | Known motif – High-throughput in vitro | GARAGGAGCTAC |
ZNF274 | ENSG00000171606 | C2H2 ZF | Known motif – High-throughput in vitro | VYGAGRACTCAYRY |
ZNF275 | ENSG00000063587 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF276 | ENSG00000158805 | C2H2 ZF | Known motif – High-throughput in vitro | WAAGGWSGWVDMKACNHCCTTWA |
ZNF277 | ENSG00000198839 | C2H2 ZF; BED ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF28 | ENSG00000198538 | C2H2 ZF | Known motif – High-throughput in vitro | GBNKSHGGGGTGCCM |
ZNF280A | ENSG00000169548 | C2H2 ZF | Known motif – In vivo/Misc source | TCTCWCCWGTRTGRRTTCTYTSAT |
ZNF280B | ENSG00000275004 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF280C | ENSG00000056277 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF280D | ENSG00000137871 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF281 | ENSG00000162702 | C2H2 ZF | Known motif – High-throughput in vitro | KGGGGGAGGGGS |
ZNF282 | ENSG00000170265 | C2H2 ZF | Known motif – High-throughput in vitro | HTCCCMYNACMCK |
ZNF283 | ENSG00000167637 | C2H2 ZF | Known motif – High-throughput in vitro | BNGGCTGRTSBKGSYBGGSYB |
ZNF284 | ENSG00000186026 | C2H2 ZF | Known motif – High-throughput in vitro | GCTGGAGTGCAG |
ZNF285 | ENSG00000267508 | C2H2 ZF | Known motif – In vivo/Misc source | TNTTYTYBYTYDYTYTNHTTT |
ZNF286A | ENSG00000187607 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF286B | ENSG00000249459 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF287 | ENSG00000141040 | C2H2 ZF | Known motif – High-throughput in vitro | AAAARAAAARRWARMARAVMWRRARRAVADR |
ZNF292 | ENSG00000188994 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF296 | ENSG00000170684 | C2H2 ZF | Known motif – High-throughput in vitro | VVTGWCCASYV |
ZNF3 | ENSG00000166526 | C2H2 ZF | Known motif – High-throughput in vitro | TGAHTGAMTRANWGA |
ZNF30 | ENSG00000168661 | C2H2 ZF | Known motif – High-throughput in vitro | CGGACGGGGCGGCTG |
ZNF300 | ENSG00000145908 | C2H2 ZF | Known motif – In vivo/Misc source | KKDGWRDDDGNRKBNDDGDDKKNRNBKRKR |
ZNF302 | ENSG00000089335 | C2H2 ZF | Known motif – High-throughput in vitro | AGTTGAGTGACTGYDSTT |
ZNF304 | ENSG00000131845 | C2H2 ZF | Known motif – High-throughput in vitro | VVGRSYVGRBYGGGGMVGGNV |
ZNF311 | ENSG00000197935 | C2H2 ZF | Known motif – In vivo/Misc source | YYSCDGCBSBNBCYS |
ZNF316 | ENSG00000205903 | C2H2 ZF | Known motif – In vivo/Misc source | KCCSCCGGACCH |
ZNF317 | ENSG00000130803 | C2H2 ZF | Known motif – High-throughput in vitro | RACAGMWGACWD |
ZNF318 | ENSG00000171467 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF319 | ENSG00000166188 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF32 | ENSG00000169740 | C2H2 ZF | Known motif – High-throughput in vitro | BGTAAYNYGAYACB |
ZNF320 | ENSG00000182986 | C2H2 ZF | Known motif – High-throughput in vitro | CMYHKKCCCCYKGVHCCCMC |
ZNF322 | ENSG00000181315 | C2H2 ZF | Known motif – High-throughput in vitro | VVGGCHSHGKASCAGDCHS |
ZNF324 | ENSG00000083812 | C2H2 ZF | Known motif – High-throughput in vitro | GRTYRAACCATCCY |
ZNF324B | ENSG00000249471 | C2H2 ZF | Known motif – In vivo/Misc source | HHHDGSMRGSHRAGG |
ZNF326 | ENSG00000162664 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF329 | ENSG00000181894 | C2H2 ZF | Known motif – High-throughput in vitro | CYKGAKCMVVCYNNDCCTGMA |
ZNF331 | ENSG00000130844 | C2H2 ZF | Known motif – High-throughput in vitro | VVAVSSNNMYWGCWGAGCMCWKYCH |
ZNF333 | ENSG00000160961 | C2H2 ZF | Known motif – High-throughput in vitro | STGGAKSM |
ZNF334 | ENSG00000198185 | C2H2 ZF | Known motif – In vivo/Misc source | YCCGKSMGGGAGGTGRGG |
ZNF335 | ENSG00000198026 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF337 | ENSG00000130684 | C2H2 ZF | Known motif – High-throughput in vitro | AGTRGTGAYRAATTC |
ZNF33A | ENSG00000189180 | C2H2 ZF | Known motif – High-throughput in vitro | TCAGTGCAC |
ZNF33B | ENSG00000196693 | C2H2 ZF | Known motif – High-throughput in vitro | ATTMAATHCCHTYYNHTDVMW |
ZNF34 | ENSG00000196378 | C2H2 ZF | Known motif – In vivo/Misc source | DRARGAVAAGYCTGD |
ZNF341 | ENSG00000131061 | C2H2 ZF | Known motif – In vivo/Misc source | VVVRRVRRNDVVNGGARSAGC |
ZNF343 | ENSG00000088876 | C2H2 ZF | Known motif – High-throughput in vitro | KRCCGHGGKGAAGCGB |
ZNF345 | ENSG00000251247 | C2H2 ZF | Known motif – High-throughput in vitro | TTGCAACVYVNRCAACYGKAC |
ZNF346 | ENSG00000113761 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF347 | ENSG00000197937 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF35 | ENSG00000169981 | C2H2 ZF | Known motif – High-throughput in vitro | ATATRTAAAGAGYTYYTABAA |
ZNF350 | ENSG00000256683 | C2H2 ZF | Known motif – High-throughput in vitro | DNBDVRKHAWAAAARRRCH |
ZNF354A | ENSG00000169131 | C2H2 ZF | Known motif – High-throughput in vitro | RTAAATGGHYTAAAY |
ZNF354B | ENSG00000178338 | C2H2 ZF | Known motif – High-throughput in vitro | AAKGRRMTAWHY |
ZNF354C | ENSG00000177932 | C2H2 ZF | Known motif – In vivo/Misc source | VTCCAC |
ZNF358 | ENSG00000198816 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF362 | ENSG00000160094 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF365 | ENSG00000138311 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF366 | ENSG00000178175 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF367 | ENSG00000165244 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF37A | ENSG00000075407 | C2H2 ZF | Known motif – High-throughput in vitro | GGARRRRRV |
ZNF382 | ENSG00000161298 | C2H2 ZF | Known motif – High-throughput in vitro | GWGVMANYASTACAGRYMHHRBDS |
ZNF383 | ENSG00000188283 | C2H2 ZF | Known motif – High-throughput in vitro | GAGSVRVRASRKGGMAGGRRBCNGGGY |
ZNF384 | ENSG00000126746 | C2H2 ZF | Known motif – High-throughput in vitro | TTTTBNNNNNNNNNNNNVAAAA |
ZNF385A | ENSG00000161642 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF385B | ENSG00000144331 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF385C | ENSG00000187595 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF385D | ENSG00000151789 | C2H2 ZF | Known motif – High-throughput in vitro | HHGTCGCGACRD |
ZNF391 | ENSG00000124613 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF394 | ENSG00000160908 | C2H2 ZF | Known motif – In vivo/Misc source | VVRGGAGNAGCWGNRVVDNV |
ZNF395 | ENSG00000186918 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF396 | ENSG00000186496 | C2H2 ZF | Known motif – High-throughput in vitro | VTTTCGKACAB |
ZNF397 | ENSG00000186812 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF398 | ENSG00000197024 | C2H2 ZF | Known motif – In vivo/Misc source | DGGGARRGARRSAG |
ZNF404 | ENSG00000176222 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF407 | ENSG00000215421 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF408 | ENSG00000175213 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF41 | ENSG00000147124 | C2H2 ZF | Known motif – High-throughput in vitro | RMARGGRARNNNRRSACMATGAGNVAV |
ZNF410 | ENSG00000119725 | C2H2 ZF | Known motif – High-throughput in vitro | MCATCCCATAATANBM |
ZNF414 | ENSG00000133250 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF415 | ENSG00000170954 | C2H2 ZF | Known motif – In vivo/Misc source | VTRCVCVMTKARBATC |
ZNF416 | ENSG00000083817 | C2H2 ZF | Known motif – In vivo/Misc source | TRGCCCAGTCAAGTTGAC |
ZNF417 | ENSG00000173480 | C2H2 ZF | Known motif – High-throughput in vitro | HNGGCGCCAVNTG |
ZNF418 | ENSG00000196724 | C2H2 ZF | Known motif – High-throughput in vitro | VDGWRGCYAAAAGCA |
ZNF419 | ENSG00000105136 | C2H2 ZF | Known motif – High-throughput in vitro | DGGARAGKMHAGGRCTGBADW |
ZNF420 | ENSG00000197050 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF423 | ENSG00000102935 | C2H2 ZF | Known motif – In vivo/Misc source | GRCACCCWAGGGTGC |
ZNF425 | ENSG00000204947 | C2H2 ZF | Known motif – In vivo/Misc source | GGBACA |
ZNF426 | ENSG00000130818 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF428 | ENSG00000131116 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF429 | ENSG00000197013 | C2H2 ZF | Known motif – High-throughput in vitro | DGGMRKAGSHVNMAATGGGYH |
ZNF43 | ENSG00000198521 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF430 | ENSG00000118620 | C2H2 ZF | Known motif – High-throughput in vitro | MCADGGHRGMNDGCHR |
ZNF431 | ENSG00000196705 | C2H2 ZF | Known motif – In vivo/Misc source | VRGGCTRGMWGNYNV |
ZNF432 | ENSG00000256087 | C2H2 ZF | Known motif – In vivo/Misc source | GTYRAAAACAAT |
ZNF433 | ENSG00000197647 | C2H2 ZF | Known motif – High-throughput in vitro | RDGACYRHWGTRRTAAYY |
ZNF436 | ENSG00000125945 | C2H2 ZF | Known motif – High-throughput in vitro | TCCTCCAGGAAGCCY |
ZNF438 | ENSG00000183621 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF439 | ENSG00000171291 | C2H2 ZF | Known motif – In vivo/Misc source | CARTCACCYYCHGGV |
ZNF44 | ENSG00000197857 | C2H2 ZF | Known motif – High-throughput in vitro | VBGNTVYKGCHGYDVNG |
ZNF440 | ENSG00000171295 | C2H2 ZF | Known motif – High-throughput in vitro | RRTKGTTCTGCW |
ZNF441 | ENSG00000197044 | C2H2 ZF | Known motif – High-throughput in vitro | SRGRCGGAGYB |
ZNF442 | ENSG00000198342 | C2H2 ZF | Known motif – In vivo/Misc source | SHWDWTWTTTNHHTTTTT |
ZNF443 | ENSG00000180855 | C2H2 ZF | Known motif – High-throughput in vitro | GYCTBCYMAGWHGCKGGBRTT |
ZNF444 | ENSG00000167685 | C2H2 ZF | Known motif – High-throughput in vitro | DGGGGGAGGGGGAYG |
ZNF445 | ENSG00000185219 | C2H2 ZF | Known motif – In vivo/Misc source | AAMTYCYYGASNRNMMAGGRKTMYYYCHC |
ZNF446 | ENSG00000083838 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF449 | ENSG00000173275 | C2H2 ZF | Known motif – High-throughput in vitro | RCGCCCAACC |
ZNF45 | ENSG00000124459 | C2H2 ZF | Known motif – High-throughput in vitro | AGGAANAYA |
ZNF451 | ENSG00000112200 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF454 | ENSG00000178187 | C2H2 ZF | Known motif – High-throughput in vitro | WRGCGCCWGGCGCYW |
ZNF460 | ENSG00000197714 | C2H2 ZF | Known motif – High-throughput in vitro | CAACGCCCCCCG |
ZNF461 | ENSG00000197808 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF462 | ENSG00000148143 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF467 | ENSG00000181444 | C2H2 ZF | Known motif – High-throughput in vitro | GGDGGGGGAGGG |
ZNF468 | ENSG00000204604 | C2H2 ZF | Known motif – High-throughput in vitro | DGGGAGGGGGYGSNS |
ZNF469 | ENSG00000225614 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF470 | ENSG00000197016 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF471 | ENSG00000196263 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF473 | ENSG00000142528 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF474 | ENSG00000164185 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF479 | ENSG00000185177 | C2H2 ZF | Known motif – High-throughput in vitro | GADGACYYKGRGGRY |
ZNF48 | ENSG00000180035 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF480 | ENSG00000198464 | C2H2 ZF | Known motif – High-throughput in vitro | DRDGAAKGDGDD |
ZNF483 | ENSG00000173258 | C2H2 ZF | Known motif – High-throughput in vitro | DSAGRGAGCTGCA |
ZNF484 | ENSG00000127081 | C2H2 ZF | Known motif – High-throughput in vitro | VRDGGAVWGVRGMASWDGVNV |
ZNF485 | ENSG00000198298 | C2H2 ZF | Known motif – High-throughput in vitro | AYTTSSWWTKKSRMYRTRKGS |
ZNF486 | ENSG00000256229 | C2H2 ZF | Known motif – In vivo/Misc source | VVBBBNSNGCSGAMDCCCGGV |
ZNF487 | ENSG00000243660 | C2H2 ZF | Known motif – In vivo/Misc source | VVBBBNSNGCSGAMDCCCGGV |
ZNF488 | ENSG00000265763 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF490 | ENSG00000188033 | C2H2 ZF | Known motif – In vivo/Misc source | HDGNMRGCAGCANAY |
ZNF491 | ENSG00000177599 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF492 | ENSG00000229676 | C2H2 ZF | Known motif – High-throughput in vitro | MNAARARMAMBAAAARGG |
ZNF493 | ENSG00000196268 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF496 | ENSG00000162714 | C2H2 ZF | Known motif – In vivo/Misc source | BCNSBCYCYBHMYYHSHBYCY |
ZNF497 | ENSG00000174586 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF500 | ENSG00000103199 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF501 | ENSG00000186446 | C2H2 ZF | Known motif – High-throughput in vitro | GCGACGCGAMCV |
ZNF502 | ENSG00000196653 | C2H2 ZF | Known motif – High-throughput in vitro | GGACYDBTGCAGTAGYHH |
ZNF503 | ENSG00000165655 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF506 | ENSG00000081665 | C2H2 ZF | Known motif – High-throughput in vitro | YTGGGGGCTCVBMC |
ZNF507 | ENSG00000168813 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF510 | ENSG00000081386 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF511 | ENSG00000198546 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF512 | ENSG00000243943 | C2H2 ZF; BED ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF512B | ENSG00000196700 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF513 | ENSG00000163795 | C2H2 ZF | Known motif – High-throughput in vitro | GATGRTGATGATGRT |
ZNF514 | ENSG00000144026 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF516 | ENSG00000101493 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF517 | ENSG00000197363 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF518A | ENSG00000177853 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF518B | ENSG00000178163 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF519 | ENSG00000175322 | C2H2 ZF | Known motif – High-throughput in vitro | GGGCGGCKGCRGCBGCGS |
ZNF521 | ENSG00000198795 | C2H2 ZF | Known motif – In vivo/Misc source | TGGGGGMCCCCW |
ZNF524 | ENSG00000171443 | C2H2 ZF; AT hook | Known motif – High-throughput in vitro | YTCGVACCC |
ZNF525 | ENSG00000203326 | C2H2 ZF | Known motif – High-throughput in vitro | RTTMCTWATDMAGNT |
ZNF526 | ENSG00000167625 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF527 | ENSG00000189164 | C2H2 ZF | Known motif – In vivo/Misc source | DGRKNGBMDGHRACAGMRR |
ZNF528 | ENSG00000167555 | C2H2 ZF | Known motif – High-throughput in vitro | GGAAGYCATTTC |
ZNF529 | ENSG00000186020 | C2H2 ZF | Known motif – In vivo/Misc source | CYCYBYCTBCYHDSM |
ZNF530 | ENSG00000183647 | C2H2 ZF | Known motif – High-throughput in vitro | GMADGGMNAGGGSCNGVV |
ZNF532 | ENSG00000074657 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF534 | ENSG00000198633 | C2H2 ZF | Known motif – High-throughput in vitro | GVGGGGMRAGARBNBVV |
ZNF536 | ENSG00000198597 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF540 | ENSG00000171817 | C2H2 ZF | Known motif – In vivo/Misc source | RGRGGVAGGVA |
ZNF541 | ENSG00000118156 | C2H2 ZF; Myb/SANT | Known motif – In vivo/Misc source | CCCATGCGCGGG |
ZNF543 | ENSG00000178229 | C2H2 ZF | Known motif – High-throughput in vitro | SSVCWGGVCMGS |
ZNF544 | ENSG00000198131 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF546 | ENSG00000187187 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF547 | ENSG00000152433 | C2H2 ZF | Known motif – High-throughput in vitro | GCWAAYKCWGCARGC |
ZNF548 | ENSG00000188785 | C2H2 ZF | Known motif – High-throughput in vitro | GBBGCKGCDGSVSSVSVG |
ZNF549 | ENSG00000121406 | C2H2 ZF | Known motif – High-throughput in vitro | ATGAAYYGGGCAGCM |
ZNF550 | ENSG00000251369 | C2H2 ZF | Known motif – High-throughput in vitro | DNVRRDGCWRRGGYAGRG |
ZNF551 | ENSG00000204519 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF552 | ENSG00000178935 | C2H2 ZF | Known motif – High-throughput in vitro | CCACGAGGGGH |
ZNF554 | ENSG00000172006 | C2H2 ZF | Known motif – High-throughput in vitro | CHGRGYCANNYRGDKDRCH |
ZNF555 | ENSG00000186300 | C2H2 ZF | Known motif – In vivo/Misc source | AAAAAGCCGCGGCGG |
ZNF556 | ENSG00000172000 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF557 | ENSG00000130544 | C2H2 ZF | Known motif – In vivo/Misc source | MAGARTGYT |
ZNF558 | ENSG00000167785 | C2H2 ZF | Known motif – High-throughput in vitro | HKGRAYHTGTRGRTKBATRYCTTYCAK |
ZNF559 | ENSG00000188321 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF560 | ENSG00000198028 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF561 | ENSG00000171469 | C2H2 ZF | Known motif – In vivo/Misc source | DSNGCMGAAARGSBBYBBBCC |
ZNF562 | ENSG00000171466 | C2H2 ZF | Known motif – In vivo/Misc source | DDYYCAGCAAGGCAMWWT |
ZNF563 | ENSG00000188868 | C2H2 ZF | Known motif – High-throughput in vitro | BTCMBNNSHRGCMRCHGY |
ZNF564 | ENSG00000249709 | C2H2 ZF | Known motif – High-throughput in vitro | GGGAAGTCCAAG |
ZNF565 | ENSG00000196357 | C2H2 ZF | Known motif – High-throughput in vitro | ATGYTGTGAGGAAGCYCA |
ZNF566 | ENSG00000186017 | C2H2 ZF | Known motif – High-throughput in vitro | VNDGCKGVAARGGARSC |
ZNF567 | ENSG00000189042 | C2H2 ZF | Known motif – High-throughput in vitro | VHAVAARHAGAMMHHNARRTG |
ZNF568 | ENSG00000198453 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF569 | ENSG00000196437 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF57 | ENSG00000171970 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF570 | ENSG00000171827 | C2H2 ZF | Known motif – High-throughput in vitro | ARAHAWMWHNMAAGAAAA |
ZNF571 | ENSG00000180479 | C2H2 ZF | Known motif – High-throughput in vitro | SSGMGGCBGMGGCRG |
ZNF572 | ENSG00000180938 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF573 | ENSG00000189144 | C2H2 ZF | Known motif – High-throughput in vitro | MAGHMMDGGCMCAMNMADB |
ZNF574 | ENSG00000105732 | C2H2 ZF | Known motif – High-throughput in vitro | CTAGAGMGKCSS |
ZNF575 | ENSG00000176472 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF576 | ENSG00000124444 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF577 | ENSG00000161551 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF578 | ENSG00000258405 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF579 | ENSG00000218891 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF580 | ENSG00000213015 | C2H2 ZF | Known motif – High-throughput in vitro | VCTACCNYHNNVCTACCNH |
ZNF581 | ENSG00000171425 | C2H2 ZF | Known motif – In vivo/Misc source | CTTCTAVAAGV |
ZNF582 | ENSG00000018869 | C2H2 ZF | Known motif – High-throughput in vitro | KYMSYTGCMGCCNARNGCAYBCYH |
ZNF583 | ENSG00000198440 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF584 | ENSG00000171574 | C2H2 ZF | Known motif – High-throughput in vitro | DNTTTMARAAHTGYTWTGGDH |
ZNF585A | ENSG00000196967 | C2H2 ZF | Known motif – High-throughput in vitro | TCYGTWYTY |
ZNF585B | ENSG00000245680 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF586 | ENSG00000083828 | C2H2 ZF | Known motif – High-throughput in vitro | CAGGCCYRGAGG |
ZNF587 | ENSG00000198466 | C2H2 ZF | Known motif – High-throughput in vitro | MCMRYGTTGGGCGCHANNHD |
ZNF587B | ENSG00000269343 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF589 | ENSG00000164048 | C2H2 ZF | Known motif – In vivo/Misc source | VSRBDRWWVCCBYKK |
ZNF592 | ENSG00000166716 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF594 | ENSG00000180626 | C2H2 ZF | Known motif – High-throughput in vitro | RDDSDGAGAGCNSS |
ZNF595 | ENSG00000272602 | C2H2 ZF | Known motif – High-throughput in vitro | GGGAGGGMWKC |
ZNF596 | ENSG00000172748 | C2H2 ZF | Known motif – High-throughput in vitro | VGVRRGAGVSMGAGM |
ZNF597 | ENSG00000167981 | C2H2 ZF | Known motif – High-throughput in vitro | CAARATGGCGKM |
ZNF598 | ENSG00000167962 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF599 | ENSG00000153896 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF600 | ENSG00000189190 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF605 | ENSG00000196458 | C2H2 ZF | Known motif – High-throughput in vitro | DGGKNNDDAGRVVCCMNRVD |
ZNF606 | ENSG00000166704 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF607 | ENSG00000198182 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF608 | ENSG00000168916 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF609 | ENSG00000180357 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF610 | ENSG00000167554 | C2H2 ZF | Known motif – High-throughput in vitro | GGAGCGGC |
ZNF611 | ENSG00000213020 | C2H2 ZF | Known motif – High-throughput in vitro | GGAGMGCCBVNGVVBVSCBSB |
ZNF613 | ENSG00000176024 | C2H2 ZF | Known motif – High-throughput in vitro | WAAAAAAAB |
ZNF614 | ENSG00000142556 | C2H2 ZF | Known motif – In vivo/Misc source | BDCTTKAKCTMATKD |
ZNF615 | ENSG00000197619 | C2H2 ZF | Known motif – High-throughput in vitro | AAABDVCTGYBSCCC |
ZNF616 | ENSG00000204611 | C2H2 ZF | Known motif – High-throughput in vitro | RHRGGTGAGCRY |
ZNF618 | ENSG00000157657 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF619 | ENSG00000177873 | C2H2 ZF | Known motif – In vivo/Misc source | BYNNBCCCCNNCCYCAGGAAT |
ZNF620 | ENSG00000177842 | C2H2 ZF | Known motif – In vivo/Misc source | WKTSYAKTY |
ZNF621 | ENSG00000172888 | C2H2 ZF | Known motif – In vivo/Misc source | RRRVKCYCAGGGMAG |
ZNF623 | ENSG00000183309 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF624 | ENSG00000197566 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF625 | ENSG00000257591 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF626 | ENSG00000188171 | C2H2 ZF | Known motif – High-throughput in vitro | HDVRTNNKGYTVHKVTGBYCCYTSYH |
ZNF627 | ENSG00000198551 | C2H2 ZF | Known motif – High-throughput in vitro | TTTAAGCCCACTGTTGAG |
ZNF628 | ENSG00000197483 | C2H2 ZF | Known motif – In vivo/Misc source | GCAACCAACCTTG |
ZNF629 | ENSG00000102870 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF630 | ENSG00000221994 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF639 | ENSG00000121864 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF641 | ENSG00000167528 | C2H2 ZF | Known motif – High-throughput in vitro | TGGGGGGGT |
ZNF644 | ENSG00000122482 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF645 | ENSG00000175809 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF646 | ENSG00000167395 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF648 | ENSG00000179930 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF649 | ENSG00000198093 | C2H2 ZF | Known motif – High-throughput in vitro | ATATAA |
ZNF652 | ENSG00000198740 | C2H2 ZF | Inferred motif from similar protein – High-throughput in vitro | |
ZNF653 | ENSG00000161914 | C2H2 ZF; AT hook | Known motif – In vivo/Misc source | WTTHNYDHCYKCCGACWNHWAWD |
ZNF654 | ENSG00000175105 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF655 | ENSG00000197343 | C2H2 ZF | Known motif – High-throughput in vitro | RVTAH |
ZNF658 | ENSG00000274349 | C2H2 ZF | Known motif – In vivo/Misc source | GGGGTRGGACGAGGTGGG |
ZNF66 | ENSG00000160229 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF660 | ENSG00000144792 | C2H2 ZF | Known motif – High-throughput in vitro | DYAGGDTGGRBHATCADB |
ZNF662 | ENSG00000182983 | C2H2 ZF | Known motif – High-throughput in vitro | DRNAGSMVVGKGMYAGMB |
ZNF664 | ENSG00000179195 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | GTTBAAWMCGC |
ZNF665 | ENSG00000197497 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF667 | ENSG00000198046 | C2H2 ZF | Known motif – High-throughput in vitro | GCYTTAARAGCTCANCH |
ZNF668 | ENSG00000167394 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF669 | ENSG00000188295 | C2H2 ZF | Known motif – High-throughput in vitro | VNHHRSANYGGTCRTCRNCCH |
ZNF670 | ENSG00000277462 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF671 | ENSG00000083814 | C2H2 ZF | Known motif – High-throughput in vitro | GAKTGGADBRV |
ZNF672 | ENSG00000171161 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF674 | ENSG00000251192 | C2H2 ZF | Known motif – High-throughput in vitro | GGRBCVCCRVV |
ZNF675 | ENSG00000197372 | C2H2 ZF | Known motif – High-throughput in vitro | RKGVNHNRGRGGMYAAAAYGD |
ZNF676 | ENSG00000196109 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF677 | ENSG00000197928 | C2H2 ZF | Known motif – High-throughput in vitro | GRAMMCHRAHAAGAWCAGHH |
ZNF678 | ENSG00000181450 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF679 | ENSG00000197123 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | DGGCAGCAGM |
ZNF680 | ENSG00000173041 | C2H2 ZF | Known motif – High-throughput in vitro | HNNNNDGNCMAAGAAGAHTNW |
ZNF681 | ENSG00000196172 | C2H2 ZF | Known motif – High-throughput in vitro | VAAGGABGVNGR |
ZNF682 | ENSG00000197124 | C2H2 ZF | Known motif – High-throughput in vitro | DDHYMAGCCC |
ZNF683 | ENSG00000176083 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF684 | ENSG00000117010 | C2H2 ZF | Known motif – High-throughput in vitro | BACAGTCCACCCCTTDV |
ZNF687 | ENSG00000143373 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF688 | ENSG00000229809 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF689 | ENSG00000156853 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF69 | ENSG00000198429 | C2H2 ZF | Known motif – In vivo/Misc source | GGRGSHGGGGBDGGV |
ZNF691 | ENSG00000164011 | C2H2 ZF | Inferred motif from similar protein – High-throughput in vitro | RKGAGYAC |
ZNF692 | ENSG00000171163 | C2H2 ZF | Known motif – In vivo/Misc source | SBGGGVCCCACH |
ZNF695 | ENSG00000197472 | C2H2 ZF | Known motif – In vivo/Misc source | ACCAMMHMC |
ZNF696 | ENSG00000185730 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF697 | ENSG00000143067 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | KKKGCGAGGGM |
ZNF699 | ENSG00000196110 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF7 | ENSG00000147789 | C2H2 ZF | Known motif – High-throughput in vitro | VWRRMADYWNYAARWGBWGRC |
ZNF70 | ENSG00000187792 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF700 | ENSG00000196757 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF701 | ENSG00000167562 | C2H2 ZF | Known motif – High-throughput in vitro | GAGMASYHDRGG |
ZNF703 | ENSG00000183779 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF704 | ENSG00000164684 | C2H2 ZF | Known motif – High-throughput in vitro | HRCCGGCCGGYD |
ZNF705A | ENSG00000196946 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | CCAAAARAAYY |
ZNF705B | ENSG00000215356 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | CCAAAARAAYY |
ZNF705D | ENSG00000215343 | C2H2 ZF | Inferred motif from similar protein – In vivo/Misc source | CCAAAARAAYY |
ZNF705E | ENSG00000214534 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF705G | ENSG00000215372 | C2H2 ZF | Known motif – In vivo/Misc source | RAKAAACCTCY |
ZNF706 | ENSG00000120963 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF707 | ENSG00000181135 | C2H2 ZF | Known motif – High-throughput in vitro | DACMAGGAGTGGGGTK |
ZNF708 | ENSG00000182141 | C2H2 ZF | Known motif – High-throughput in vitro | RDDAGGYACAGCH |
ZNF709 | ENSG00000242852 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF71 | ENSG00000197951 | C2H2 ZF | Known motif – High-throughput in vitro | BRGNRGSMRRRGVRARRARRGMAA |
ZNF710 | ENSG00000140548 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF711 | ENSG00000147180 | C2H2 ZF | Known motif – In vivo/Misc source | MGGCCTVS |
ZNF713 | ENSG00000178665 | C2H2 ZF | Known motif – High-throughput in vitro | WAGAMRAAWGCCACGAA |
ZNF714 | ENSG00000160352 | C2H2 ZF | Known motif – High-throughput in vitro | DKMRKTSCTGCT |
ZNF716 | ENSG00000182111 | C2H2 ZF | Known motif – High-throughput in vitro | VTATTTCY |
ZNF717 | ENSG00000227124 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF718 | ENSG00000250312 | C2H2 ZF | Known motif – In vivo/Misc source | GGGRATWGCGM |
ZNF721 | ENSG00000182903 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF724 | ENSG00000196081 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF726 | ENSG00000213967 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF727 | ENSG00000214652 | C2H2 ZF | Known motif – In vivo/Misc source | GGTCCAAWTGM |
ZNF728 | ENSG00000269067 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF729 | ENSG00000196350 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF730 | ENSG00000183850 | C2H2 ZF | Known motif – High-throughput in vitro | GGGMRGSBRNGG |
ZNF732 | ENSG00000186777 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF735 | ENSG00000223614 | C2H2 ZF | Known motif – In vivo/Misc source | DGGCAGCAGM |
ZNF736 | ENSG00000234444 | C2H2 ZF | Known motif – High-throughput in vitro | YCYRGGGYTTTT |
ZNF737 | ENSG00000237440 | C2H2 ZF | Known motif – In vivo/Misc source | RKRVDGRDGVWGGDG |
ZNF74 | ENSG00000185252 | C2H2 ZF | Known motif – In vivo/Misc source | RAAGATGTTCHYYDCVKYRTTRTTTAHVW |
ZNF740 | ENSG00000139651 | C2H2 ZF | Known motif – High-throughput in vitro | YNCCCCCCCCAC |
ZNF746 | ENSG00000181220 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF747 | ENSG00000169955 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF749 | ENSG00000186230 | C2H2 ZF | Known motif – High-throughput in vitro | GYTGGGGYT |
ZNF750 | ENSG00000141579 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF75A | ENSG00000162086 | C2H2 ZF | Known motif – High-throughput in vitro | TGTGGGAAAASM |
ZNF75D | ENSG00000186376 | C2H2 ZF | Known motif – High-throughput in vitro | GTGGGAAAKCCTTYH |
ZNF76 | ENSG00000065029 | C2H2 ZF | Known motif – High-throughput in vitro | HWCCCABAATGCAHYRCR |
ZNF761 | ENSG00000160336 | C2H2 ZF | Known motif – In vivo/Misc source | KGDWAATCAKA |
ZNF763 | ENSG00000197054 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF764 | ENSG00000169951 | C2H2 ZF | Known motif – In vivo/Misc source | TGCARCCYAGCTCTAYDAGMC |
ZNF765 | ENSG00000196417 | C2H2 ZF | Known motif – High-throughput in vitro | CTBGGCHVNGCMCWGVS |
ZNF766 | ENSG00000196214 | C2H2 ZF | Known motif – In vivo/Misc source | RAKAAACCYYH |
ZNF768 | ENSG00000169957 | C2H2 ZF | Known motif – High-throughput in vitro | CHCAGAGAGGKYRAG |
ZNF77 | ENSG00000175691 | C2H2 ZF | Known motif – In vivo/Misc source | TYMYCACTYCACYHNNNHMAD |
ZNF770 | ENSG00000198146 | C2H2 ZF | Known motif – In vivo/Misc source | GGAGGCYGVVV |
ZNF771 | ENSG00000179965 | C2H2 ZF | Known motif – High-throughput in vitro | RCGCTAACCAYTD |
ZNF772 | ENSG00000197128 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF773 | ENSG00000152439 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF774 | ENSG00000196391 | C2H2 ZF | Known motif – High-throughput in vitro | DGRRRVRGAGVHDGRRD |
ZNF775 | ENSG00000196456 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF776 | ENSG00000152443 | C2H2 ZF | Known motif – High-throughput in vitro | GAAGCAHRRYGCYGGCATCTG |
ZNF777 | ENSG00000196453 | C2H2 ZF | Known motif – In vivo/Misc source | GHCCSYCCCGTCSARCAAW |
ZNF778 | ENSG00000170100 | C2H2 ZF | Known motif – High-throughput in vitro | CAGACRMCRRCH |
ZNF780A | ENSG00000197782 | C2H2 ZF | Known motif – High-throughput in vitro | VNNNNDNNHDGGCAGGYNBNYDDV |
ZNF780B | ENSG00000128000 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF781 | ENSG00000196381 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF782 | ENSG00000196597 | C2H2 ZF | Known motif – In vivo/Misc source | HARRHCCWACAHVDRGRSHNYCTCAVRVVY |
ZNF783 | ENSG00000204946 | C2H2 ZF | Known motif – In vivo/Misc source | SBTSCWSCDSCDSYDSCWGCT |
ZNF784 | ENSG00000179922 | C2H2 ZF | Known motif – High-throughput in vitro | ACYTWCCK |
ZNF785 | ENSG00000197162 | C2H2 ZF | Known motif – In vivo/Misc source | ACWBRBRCAYACASWYVMMCVMACACASA |
ZNF786 | ENSG00000197362 | C2H2 ZF | Known motif – In vivo/Misc source | CRGRGNCCCRRRGRC |
ZNF787 | ENSG00000142409 | C2H2 ZF | Known motif – High-throughput in vitro | BGAGGCANNNNNNNTGCATY |
ZNF788 | ENSG00000214189 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF789 | ENSG00000198556 | C2H2 ZF | Known motif – High-throughput in vitro | CYYSTGACACCH |
ZNF79 | ENSG00000196152 | C2H2 ZF | Known motif – High-throughput in vitro | AAAVRAAWDAATNTCTAA |
ZNF790 | ENSG00000197863 | C2H2 ZF | Known motif – High-throughput in vitro | GTGCAGCA |
ZNF791 | ENSG00000173875 | C2H2 ZF | Known motif – In vivo/Misc source | CKCTGACCCCDCCTCCYBTCTAAA |
ZNF792 | ENSG00000180884 | C2H2 ZF | Known motif – In vivo/Misc source | DRCTGDTKWNHDBAGATAGKR |
ZNF793 | ENSG00000188227 | C2H2 ZF | Known motif – High-throughput in vitro | GARCCCCAAGVV |
ZNF799 | ENSG00000196466 | C2H2 ZF | Known motif – High-throughput in vitro | AYMCYBGYTGTCTCAGTGWTTKGS |
ZNF8 | ENSG00000278129 | C2H2 ZF | Known motif – High-throughput in vitro | DHNDDGRCRTACCRBV |
ZNF80 | ENSG00000174255 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF800 | ENSG00000048405 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF804A | ENSG00000170396 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF804B | ENSG00000182348 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF805 | ENSG00000204524 | C2H2 ZF | Known motif – High-throughput in vitro | MYKSCATTCCWTKSCWTKYSR |
ZNF808 | ENSG00000198482 | C2H2 ZF | Known motif – High-throughput in vitro | GGNWGGWCTVYAAAVNVSHYKBTHNDKND |
ZNF81 | ENSG00000197779 | C2H2 ZF | Known motif – High-throughput in vitro | TGGTVNHACYABYNNRRA |
ZNF813 | ENSG00000198346 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF814 | ENSG00000204514 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF816 | ENSG00000180257 | C2H2 ZF | Known motif – High-throughput in vitro | VVNNRDGGGGACMKGHND |
ZNF821 | ENSG00000102984 | C2H2 ZF | Known motif – High-throughput in vitro | HRGACAGACVGACR |
ZNF823 | ENSG00000197933 | C2H2 ZF | Known motif – High-throughput in vitro | HHYTTCTCYNYYBCY |
ZNF827 | ENSG00000151612 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF829 | ENSG00000185869 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF83 | ENSG00000167766 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF830 | ENSG00000198783 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF831 | ENSG00000124203 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF835 | ENSG00000127903 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF836 | ENSG00000196267 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF837 | ENSG00000152475 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF84 | ENSG00000198040 | C2H2 ZF | Known motif – High-throughput in vitro | RVRRVNNVNRDGAACAGGMAR |
ZNF841 | ENSG00000197608 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF843 | ENSG00000176723 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF844 | ENSG00000223547 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF845 | ENSG00000213799 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF846 | ENSG00000196605 | C2H2 ZF | Known motif – In vivo/Misc source | GVGSMVGGGMSVSVG |
ZNF85 | ENSG00000105750 | C2H2 ZF | Known motif – High-throughput in vitro | BRGATTMCWKCA |
ZNF850 | ENSG00000267041 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF852 | ENSG00000178917 | C2H2 ZF | Inferred motif from similar protein – High-throughput in vitro | VYAHACTKTNRAGYGV |
ZNF853 | ENSG00000236609 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF860 | ENSG00000197385 | C2H2 ZF | Known motif – High-throughput in vitro | VRCAGGGAGCVRVVS |
ZNF865 | ENSG00000261221 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF878 | ENSG00000257446 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF879 | ENSG00000234284 | C2H2 ZF | Known motif – High-throughput in vitro | AHARHAMWAHWRAAMMWANWWRVH |
ZNF880 | ENSG00000221923 | C2H2 ZF | Known motif – High-throughput in vitro | DDNDDVDNGGGRRDGGGARAGDGMAR |
ZNF883 | ENSG00000228623 | C2H2 ZF | Known motif – In vivo/Misc source | GAGGCAGCCACH |
ZNF888 | ENSG00000213793 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF891 | ENSG00000214029 | C2H2 ZF | Known motif – High-throughput in vitro | BNNNNSNGRCWKCYAGCC |
ZNF90 | ENSG00000213988 | C2H2 ZF | Known motif – High-throughput in vitro | TGGGTGDRTMAKCAG |
ZNF91 | ENSG00000167232 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF92 | ENSG00000146757 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZNF93 | ENSG00000184635 | C2H2 ZF | Known motif – High-throughput in vitro | BNNNBNHNGCWGCHRBSNYWGCTRCYDYC |
ZNF98 | ENSG00000197360 | C2H2 ZF | Known motif – High-throughput in vitro | VNADRKMCAANAAAAAGGHM |
ZNF99 | ENSG00000213973 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZSCAN1 | ENSG00000152467 | C2H2 ZF | Known motif – High-throughput in vitro | HRCACACVCTGHMAVH |
ZSCAN10 | ENSG00000130182 | C2H2 ZF | Inferred motif from similar protein – High-throughput in vitro | GDRAGTGC |
ZSCAN12 | ENSG00000158691 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZSCAN16 | ENSG00000196812 | C2H2 ZF | Known motif – High-throughput in vitro | GAGGCTCTGTTAACANY |
ZSCAN18 | ENSG00000121413 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZSCAN2 | ENSG00000176371 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZSCAN20 | ENSG00000121903 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZSCAN21 | ENSG00000166529 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZSCAN22 | ENSG00000182318 | C2H2 ZF | Known motif – High-throughput in vitro | GNCHGABGGMGGAGGCNV |
ZSCAN23 | ENSG00000187987 | C2H2 ZF | Known motif – High-throughput in vitro | BTGTAATTAGCACATGR |
ZSCAN25 | ENSG00000197037 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZSCAN26 | ENSG00000197062 | C2H2 ZF | Known motif – In vivo/Misc source | TGGGGGGCATM |
ZSCAN29 | ENSG00000140265 | C2H2 ZF | Known motif – High-throughput in vitro | MCGYRTARMCGKCTAYRC |
ZSCAN30 | ENSG00000186814 | C2H2 ZF | Known motif – High-throughput in vitro | BCCWGSRGCCHBSVS |
ZSCAN31 | ENSG00000235109 | C2H2 ZF | Known motif – High-throughput in vitro | GHHGCAGGGCARTTATGC |
ZSCAN32 | ENSG00000140987 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZSCAN4 | ENSG00000180532 | C2H2 ZF | Known motif – High-throughput in vitro | HGCACACVCTGNMA |
ZSCAN5A | ENSG00000131848 | C2H2 ZF | Known motif – High-throughput in vitro | HKTCCCYVCVCAAADM |
ZSCAN5B | ENSG00000197213 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZSCAN5C | ENSG00000204532 | C2H2 ZF | Known motif – High-throughput in vitro | GTGAGTNHAYRRRNV |
ZSCAN9 | ENSG00000137185 | C2H2 ZF | Known motif – High-throughput in vitro | DRKGATAAGATAAGAABCM |
ZUFSP | ENSG00000153975 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZXDA | ENSG00000198205 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZXDB | ENSG00000198455 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZXDC | ENSG00000070476 | C2H2 ZF | Likely sequence specific TF according to literature or domain structure – No motif | |
ZZZ3 | ENSG00000036549 | Myb/SANT | Known motif – High-throughput in vitro | SAATCCAW |
References
- Lambert, Samuel; Arttu, Jolma; Campitelli, Laura; Das, Pratyush; Yin, Yimeng; Albu, Mihai; Chen, Xiaoting; Taipale, Jussi; Hughes, Timothy; Weirauch, Matthew (February 2018). "The Human Transcription Factors". Cell. 172 (4): 650–665. doi:10.1016/j.cell.2018.01.029. PMID 29425488.
This article is issued from Wikipedia. The text is licensed under Creative Commons - Attribution - Sharealike. Additional terms may apply for the media files.